.
The Open Protein Structure Annotation Network
PDB Keyword
.

402948

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 402948
    Molecular Characteristics
    Source Geobacter metallireducens gs-15
    Alias Ids TPS30766,YP_386183.1 Molecular Weight 49727.91 Da.
    Residues 459 Isoelectric Point 5.48
    Sequence mldnriidelktivgadnvatdrqdlicygydatqmeflpdavvhpgspdevsavlklanreqfpvypr gagsgftggalpkgggivlvvtrlnrilridtenliaevepgvvteqfqleveklglfyppdpaslkfs tlggnvaenaggprcvkygvtrdfvmglevvlpsgeiirtggetykgvvgydltrllcgsegtlgvitk iifkllplpeakktmmtifdsidgaakavstiignkiipttlefmdhatlqcvekrfnlgipasgravl iievdgdrdliekqaariqelikplglveckiakdaaesealwkvrrlvspslrdvnpdkfnedivvpr skvpdvirviekiqqkyaipivnfghagdgnihvnimidksvagqeekaheaiaevfqaaldlngtmsg ehgvglakqpyihlelkpaqvatmqaikkaldpnnilnpgkmfpv
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch