.
The Open Protein Structure Annotation Network
PDB Keyword
.

402891

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 402891
    Molecular Characteristics
    Source Fusobacterium nucleatum subsp. nucleatum atcc 25586
    Alias Ids TPS30759,NP_604169.1, _0091.000233_, 322346 Molecular Weight 25036.74 Da.
    Residues 211 Isoelectric Point 5.35
    Sequence mnsdidkkylilekakdmiitesysslsiskltselsiskgsfytyfpskdkmlseildeyikniiifk nnllensknidecldyyinsilsltdeelklelvitnlkrnyevfneenfkklkiiactmidfvkevln kykndinidekdiekcskmifsiaevflimenvdfnsdrfsfktlnevkkmyrsdemkehlefikksik kily
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch