.
The Open Protein Structure Annotation Network
PDB Keyword
.

402713

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 402713
    Molecular Characteristics
    Source Colwellia psychrerythraea 34h
    Alias Ids TPS30752,YP_270173.1 Molecular Weight 13406.17 Da.
    Residues 120 Isoelectric Point 4.29
    Sequence mnnqqanqlirtlytavdskdlnyleetlcddvkfrignydtisdkaaalaanqeffgsiesmshtidk vwsvendvlcnglvdyirldgsahsayfstvltmdngkiaeyfvyadisgl
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch