The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 402648
    Molecular Characteristics
    Source Chromobacterium violaceum atcc 12472
    Alias Ids TPS31000,NP_902731.1, _0086.000444_, _0070.000759_, _0004.000838_, _0018.000912_, _0095.004355_, _0013.003029_, 325080 Molecular Weight 32263.80 Da.
    Residues 297 Isoelectric Point 6.11
    Sequence meiyqlrtfvtvaqqghltqaaellhlsqpavtaqikaleeevgmplfernaggvsltragqellpqaq gvlaaardiinhakqlkgqlsgqarvgvtlmpdilklgpwvaalvsahpllevqlthgvsvdvlnlvrk keldagfylgknpymnvstvplqtldfrvalppawagqmasgklkdlgklpwvgisqfsslskitaelw reinispkkvaesdhlavilelvaagvgaalvreeealaweaegrvwlvpdlrkraelqfvypadragd pvletllrellavwglpcpqa
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch