The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Putative cell adhesion protein (BF1858) from Bacteroides fragilis NCTC 9343 at 2.33 A resolution. To be published
    Site JCSG
    PDB Id 3t2l Target Id 393159
    Molecular Characteristics
    Source Bacteroides fragilis nctc 9343
    Alias Ids TPS26573,YP_211493.1, 324067 Molecular Weight 34002.44 Da.
    Residues 307 Isoelectric Point 4.53
    Sequence sddremddgrwkasalrvplqvssavikqevvtrlapdpvpltegaigiflsgtepesgqedsgykvid nrkyvyseghwgpptandtiylvgndadvcayypykdsytdktviplqsqdyvetediyyalntmingf tpaitfdmvhayslvelkisrenyfmpceiskitlknsnlikkgtiniavdgsihssetgnydlttvtd asphtlsvgesyvcrvlmipvplkiertdaeggefglsvslvidgqqmlveipyselgefrqgekyvig lkikgteivptvkalewedeevnggnkypve
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.33 Rfree 0.2192
    Matthews' coefficent 3.25 Rfactor 0.1754
    Waters 150 Solvent Content 62.11

    Ligand Information


    Google Scholar output for 3t2l

    Protein Summary

    This structure is similar to previous JCSG structures 3gf8, 3liu, 3pay, 3r4r, 393142, likely involved in fimbrae formation. It demonstrate a novel form of oligomerization (dimer) through stand swapping.


    This type of proteins are highly abundant in gut bacteria, potentially important for host interaction. Further investigation will be conducted when more structures become available (all targets will be tagged 3gf8-related).


    This protein (BF1858) appears to be from the same operon as 393142(BF1861). It is noted that the putative operon consists of many proteins of similar fold.


    bfs:BF1843           putative phage integrase/recombinase 
    bfs:BF1844           hypothetical protein 
    bfs:BF1845           putative integrase/transposase 
    bfs:BF1846           hypothetical protein 
    bfs:BF1847           hypothetical protein 
    bfs:BF1848           hypothetical protein 
    bfs:BF1849           hypothetical protein 
    bfs:BF1850           hypothetical protein 
    bfs:BF1851           ortholog to Mfa2, 3gf8 
    bfs:BF1852           FimA family, major fibrae unit, ATP/GTP-binding chaperonin 
    bfs:BF1853           hypothetical protein 
    bfs:BF1854           paralog 
    bfs:BF1855           paralog 
    bfs:BF1856           paralog 
    bfs:BF1857           paralog 
    bfs:BF1858           paralog -solved 393159
    bfs:BF1859           paralog 
    bfs:BF1860           paralog 
    bfs:BF1861           paralog -solved 393142
    bfs:BF1862           hypothetical protein, paralog to BF1865, DUF1735, related to 3n91, 3nqk 
    bfs:BF1863           paralog 
    bfs:BF1864           paralog 
    bfs:BF1865           hypothetical protein 
    bfs:BF1866           paralog 
    bfs:BF1867           hypothetical protein 
    bfs:BF1868           contains a BACON domain, may bind carbohydrate or adhesion
    bfs:BF1869           hypothetical protein 
    bfs:BF1870           3ewl, hypothetical protein 


    Fig. 1 domain swapped dimer


    Ligand Summary




    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    93.07 kB16:30, 8 Jul 2011qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch