The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a DUF1989 family protein (TM1040_0329) from SILICIBACTER SP. TM1040 at 1.35 A resolution. To be published
    Site JCSG
    PDB Id 3siy Target Id 383406
    Related PDB Ids 3oru 
    Molecular Characteristics
    Source Silicibacter sp. tm1040
    Alias Ids TPS7411,YP_612324.1, BIG_837, BIG_202, 87812 Molecular Weight 25835.00 Da.
    Residues 233 Isoelectric Point 5.82
    Sequence mtsfdrpfeaarpdgenpsahetlaeggrlrpeatytiparqgrairmaqgealmvinrdgsqigdfwa fvegdcgeylsmehlrptlrrvsprpgdvlvsnrrrpiltlledsspgvhdtlvascdvhryaqlgheg yhdnctdnlrmalgalglrpttvpcplnlwmntpvveggamewrppvsrrgdhvlfraeldvvvviscc pmdllpingeeaqpraldvrlrprpa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.35 Rfree 0.1715
    Matthews' coefficent 1.95 Rfactor 0.1373
    Waters 1089 Solvent Content 36.83

    Ligand Information


    Google Scholar output for 3siy

    Protein Summary

     Pfam update:This protein is in DUF1989, PF09347. Target 383110, 3di4. has already been solved for this family, and there is some information that we could use from TOPSAN to update the family.

    The structure of this protein is shown below.


    The magenta sphere is the zinc ion bound to the structure.


    There are two crystal forms of this structure.  Both forms have Zn bound to them. The two structures are fairly identical except for a slight movement in one of the loops, shown below.


    The two structures superpose with a rmsd of 0.366 A over the full length of the protein.


    The dimerization interface is also the same in both the crystal forms:

    3oru_dimer.png  S4239_dimer.png

    Ligand Summary




    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch