.
The Open Protein Structure Annotation Network
PDB Keyword
.

3sd2

    Title Crystal structure of a Putative member of DUF3244 protein family (BT_3571) from Bacteroides thetaiotaomicron VPI-5482 at 1.40 A resolution. To be published
    Site JCSG
    PDB Id 3sd2 Target Id 393020
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi-5482
    Alias Ids TPS20289,NP_812483.1, 324996 Molecular Weight 11072.06 Da.
    Residues 100 Isoelectric Point 6.04
    Sequence ansndihllkdsrsnpmgipiqptyekcailsnilnvsfgrakdyaiitvtnkatgeivhsktyhntsi vmidmsscekgeytihiilndcllegtftvq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.40 Rfree 0.2043
    Matthews' coefficent 2.38 Rfactor 0.1616
    Waters 104 Solvent Content 48.24

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3sd2

    Protein Summary

    The protein NP_812483.1 is annotated as hypothetical protein BT3571. A PFAM sequence search of NP_812483.1 indicates that the protein belongs to Domain of unknown function, DUF3244 (PF11589).

     

    The monomer structure has a common Immunoglobulin fold.

    GS13719A.png

     

    The protein might assemble as a dimer, based on the crystallographic packing, shown below.

    GS13719A_dim.png

     

    There are a few structural homologs of this protein.

    Top 10 DALI Structural Homologs
     
    N PDB Z-score RMSD LALI NRES %ID Description (JCSG structures highlighted in red)
    1 3d33 11.9 0.9 72 93 19 Domain of Unknown Function with an Immunoglobulin
    2 2fnb 8.5 3.9 76 95 16 Protein (fibronectin)
    3 3gm8 8.1 5.4 76 770 8 Glycoside Hydrolase Family 2, Candidate Beta-
    4 3fn9 7.7 2.9 77 672 10 Putative Beta-galactosidase
    5 3qht 7.5 2.4 69 93 19 Ubiquitin-like Protein Smt3
    6 3k2m 7.5 5.5 76 101 18 Proto-oncogene Tyrosine-protein Kinase Abl1
    7 3im1 7.5 4.0 76 325 11 Pre-mrna-splicing Helicase Brr2
    8 3lpf 7.4 3.0 72 603 6 Beta-glucuronidase
    9 3im2 7.4 4.0 76 320 11 Pre-mrna-splicing Helicase Brr2
    10 1f4h 7.4 4.3 78 1021 10 Beta-galactosidase

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch