.
The Open Protein Structure Annotation Network
PDB Keyword
.

3s5q

    Title Crystal structure of a Hypothetical Glycosyl hydrolase (BDI_2473) from Parabacteroides distasonis ATCC 8503 at 1.85 A resolution. To be published
    Site JCSG
    PDB Id 3s5q Target Id 394767
    Molecular Characteristics
    Source Parabacteroides distasonis atcc 8503
    Alias Ids TPS27899,YP_001303815.1, 325888 Molecular Weight 22264.82 Da.
    Residues 195 Isoelectric Point 5.17
    Sequence yrplfdkdlsnadydssvwtfkngiltatadqsiwtkvqyenfildlefktdvntnsgvviyctdkgnw ipssieiqiaddhhpewqsypeywrcgsiyghkganeqlvvkkpgewnrmiitakgqqidielngkhiv sanladwtsgttnpdgteipewlpipyanmptkgyiglqgkhgesniwfrniqlkql
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.2018
    Matthews' coefficent 1.94 Rfactor 0.1693
    Waters 190 Solvent Content 36.52

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3s5q

    Protein Summary

    The protein YP_001303815.1 is annotated as Hypothetical Glycosyl hydrolase. YP_001303815.1 belongs to PFAM PF06439 DUF1080.

     

    The monomer structure is shown below.

    GS13660A.png

     

    There are a few structural homologs; the closest being another hypothetical glycosyl hydrolase.

    SSM Structural Homologs
     
    N PDB Q-score RMSD Nalgn Nres-T %seq Description (JCSG structures highlighted in red)
    1 3imm 0.8574 0.781 196 197 59.7 Putative Glycosyl Hydrolase (YP_001301887.1) from Parabacteroides Distasonis ATCC 8503 at 2.00 A Resolution
    Top 10 DALI Structural Homologs
     
    N PDB Z-score RMSD LALI NRES %ID Description (JCSG structures highlighted in red)
    1 3imm 34.5 0.9 197 197 59 Putative Secreted Glycosylhydrolase
    2 3h3l 22.0 2.4 189 223 23 Putative Sugar Hydrolase
    3 3nmb 21.9 2.1 190 256 25 Putative Sugar Hydrolase
    4 3osd 21.4 2.2 190 264 25 Putative Glycosyl Hydrolase
    5 3hbk 21.4 2.8 193 231 24 Putative Glycosyl Hydrolase
    6 1oq1 14.9 3.0 167 220 11 Protein Yesu
    7 3lcp 13.6 2.8 163 234 12 Protein Ergic-53
    8 3a4u 13.6 2.8 162 228 12 Protein Ergic-53
    9 1r1z 13.6 3.0 169 247 12 Ergic-53 Protein
    10 2eig 13.5 2.6 157 230 9 Lectin

    A superposition of 3imm (green) on this structure (cyan) is shown below.

    GS13660A_3imm.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
     GS13660A.png
    No description
    70.34 kB17:01, 18 May 2011abhinavkActions
     GS13660A_3imm.png
    No description
    96.8 kB17:01, 18 May 2011abhinavkActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch