.
The Open Protein Structure Annotation Network
PDB Keyword
.

3s25

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Hypothetical 7-bladed beta-propeller-like protein (EUBREC_1955, ERE_32420) from Eubacterium rectale at 1.88 A resolution. To be published
    Site JCSG
    PDB Id 3s25 Target Id 390003
    Molecular Characteristics
    Source Eubacterium rectale atcc 33656
    Alias Ids TPS7654,YP_002937831.1, 283193 Molecular Weight 34508.41 Da.
    Residues 301 Isoelectric Point 5.68
    Sequence lnssyvngntagnlynaglfcesdgevffsntndngrlyamnidgsnihklsndtamyinadknyvyyv rnnnqkitsqtffsydrnslcrikrnghgstvldpdpciyaslignyiyylhydtqtatslyriridge ekkkiknhylftcntsdryfyynnpkngqlyrydtasqsealfydcncykpvvlddtnvyymdvnrdna ivhvninnpnpvvlteaniehynvygslifyqrggdnpalcvvkndgtgfkelakgefcninvtsqyvy ftdfvsnkeyctstqnpdtikalqp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.88 Rfree 0.1829
    Matthews' coefficent 2.73 Rfactor 0.1583
    Waters 172 Solvent Content 54.94

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3s25

    Protein Summary

    The protein structure reveals a 7-bladed propeller in which each blade is comprised of ~40 residues. This is a secreted protein. The structure is similar to that of WD40/YVTN repeat-like domains, which usually have distinct sequences.

    Fig1.png

    Top structurally similar proteins as found by SSM are the beta-propeller domain of the P. furiosus trilobed protease (PDB id 2gop, Q-score 0.31, 3.3A rmsd, 9% sequence identity), the S. aureus virginiamycin B lyase (PDB id 2z2o, Q-score 0.28, 3.2A rmsd, 12% seq id), WDR5 (Q-score 0.27, 3.5A rmsd, 9% seq id).

    This protein is also similar in structure to TolB (~10-12% seq id to PDB ids 1c5k and 2ojh), which is involved in translocation.

    Proteins with WD repeats are involved in a wide variety of functions including enzyme function and scaffolding for forming protein-protein complexes and have been reviewed in several papers (PMID: 10322433, PMID: 8090199, PMID: 21468892).

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
     Fig1.png
    No description
    312.67 kB18:06, 6 Apr 2011debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch