.
The Open Protein Structure Annotation Network
PDB Keyword
.

3rf7

    Table of contents
        1. 1.1.1. Protein Summary
    1. 2. Summary
        1. 2.1.1. Ligand Summary

    Title Crystal structure of an Iron-containing alcohol dehydrogenase (Sden_2133) from Shewanella denitrificans OS-217 at 2.12 A resolution. To be published
    Site JCSG
    PDB Id 3rf7 Target Id 394060
    Molecular Characteristics
    Source Shewanella denitrificans os217
    Alias Ids TPS27823,YP_563138.1, _0108.0002956_, 326287 Molecular Weight 39475.27 Da.
    Residues 356 Isoelectric Point 5.08
    Sequence msfknfkcvpkmifgrgsfvqldtvleqertdandfvvflvddvhqhkplaarvpnkahdlviyvnvdd epttvqvdeltaqvkafntklpvsvvglgggstmdlakavslmltnpgssseyqgwdliknpavhhigi ptvsgtgaeasrtavlcgpvrklglnsdytvfdqiimdseliagvptdqwfytgmdcfihcveslqgty lnefakafaeksmdlcrevylddhpekddklmmasymggmsiaysqvgachavsyglgyvlgyhhgign clafdvleefypegvaefrkmmeihnitlpknickdlpdetiakmvavtksmgplwdnvygkgweekvt demltklfrri
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.12 Rfree 0.1968
    Matthews' coefficent Rfactor 0.1819
    Waters 358 Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3rf7

    Protein Summary

    Pfam update: Fe-ADH (PF00465) family

    394060 from SHEWANELLA DENITRIFICANS OS-217 encodes a protein which belongs to Pfam; PF00465; Fe-ADH. Crystal structure of 394060 contains one protomer in asu, however biological molecule is a dimer.monomer_MH.png

    Fig. 1 One protomer found in the asu.   394060 is color-coded from blue (N-terminal) to red (C-terminal). NAD is shown as stick.

     

    dimer_MH.png

    Fig. 2 Dimer of  394060

    Summary

        No:  Chain   Z    rmsd lali nres  %id PDB  Description
    1: 1rrm-A 40.8 2.3 336 385 19 PDB MOLECULE: LACTALDEHYDE REDUCTASE; 2: 1rrm-B 40.8 2.3 336 384 19 PDB MOLECULE: LACTALDEHYDE REDUCTASE; 3: 2bl4-B 40.5 2.4 337 382 18 PDB MOLECULE: LACTALDEHYDE REDUCTASE; 4: 2bi4-B 40.4 2.4 337 382 18 PDB MOLECULE: LACTALDEHYDE REDUCTASE; 5: 3bfj-S 40.4 2.4 336 382 18 PDB MOLECULE: 1,3-PROPANEDIOL OXIDOREDUCTASE; 6: 2bl4-A 40.3 2.4 337 382 18 PDB MOLECULE: LACTALDEHYDE REDUCTASE; 7: 2bi4-A 40.3 2.4 336 382 18 PDB MOLECULE: LACTALDEHYDE REDUCTASE; 8: 3bfj-H 40.0 2.5 336 382 18 PDB MOLECULE: 1,3-PROPANEDIOL OXIDOREDUCTASE; 9: 3bfj-C 39.7 2.5 336 382 18 PDB MOLECULE: 1,3-PROPANEDIOL OXIDOREDUCTASE; 10: 3bfj-A 39.6 2.5 337 382 18 PDB MOLECULE: 1,3-PROPANEDIOL OXIDOREDUCTASE; 11: 3bfj-P 39.6 2.5 337 382 18 PDB MOLECULE: 1,3-PROPANEDIOL OXIDOREDUCTASE; 12: 3bfj-B 39.5 2.6 336 382 18 PDB MOLECULE: 1,3-PROPANEDIOL OXIDOREDUCTASE; 13: 3bfj-E 39.5 2.5 336 382 18 PDB MOLECULE: 1,3-PROPANEDIOL OXIDOREDUCTASE; 14: 3bfj-Q 39.4 2.6 336 382 18 PDB MOLECULE: 1,3-PROPANEDIOL OXIDOREDUCTASE; 15: 3bfj-F 39.4 2.6 336 382 18 PDB MOLECULE: 1,3-PROPANEDIOL OXIDOREDUCTASE; 16: 3bfj-G 39.4 2.6 337 382 18 PDB MOLECULE: 1,3-PROPANEDIOL OXIDOREDUCTASE; 17: 3bfj-R 39.4 2.6 336 382 18 PDB MOLECULE: 1,3-PROPANEDIOL OXIDOREDUCTASE; 18: 3bfj-J 39.4 2.5 336 382 18 PDB MOLECULE: 1,3-PROPANEDIOL OXIDOREDUCTASE; 19: 3bfj-O 39.3 2.6 336 382 18 PDB MOLECULE: 1,3-PROPANEDIOL OXIDOREDUCTASE; 20: 3bfj-I 39.3 2.6 336 382 18 PDB MOLECULE: 1,3-PROPANEDIOL OXIDOREDUCTASE; 21: 3bfj-N 39.3 2.5 336 382 18 PDB MOLECULE: 1,3-PROPANEDIOL OXIDOREDUCTASE; 22: 3bfj-K 39.2 2.6 337 382 18 PDB MOLECULE: 1,3-PROPANEDIOL OXIDOREDUCTASE; 23: 3bfj-D 39.2 2.6 336 382 18 PDB MOLECULE: 1,3-PROPANEDIOL OXIDOREDUCTASE; 24: 3bfj-M 39.2 2.6 336 382 18 PDB MOLECULE: 1,3-PROPANEDIOL OXIDOREDUCTASE; 25: 3bfj-L 39.1 2.6 336 382 18 PDB MOLECULE: 1,3-PROPANEDIOL OXIDOREDUCTASE; 26: 3bfj-T 39.0 2.6 338 382 18 PDB MOLECULE: 1,3-PROPANEDIOL OXIDOREDUCTASE; 27: 1o2d-A 37.1 2.8 330 358 20 PDB MOLECULE: ALCOHOL DEHYDROGENASE, IRON-CONTAINING; 28: 1vhd-A 37.0 2.8 331 361 20 PDB MOLECULE: ALCOHOL DEHYDROGENASE, IRON-CONTAINING; 29: 1o2d-B 36.9 2.9 332 360 20 PDB MOLECULE: ALCOHOL DEHYDROGENASE, IRON-CONTAINING; 30: 1vhd-B 36.6 2.8 329 361 21 PDB MOLECULE: ALCOHOL DEHYDROGENASE, IRON-CONTAINING; 31: 1vlj-A 34.5 2.9 333 398 20 PDB MOLECULE: NADH-DEPENDENT BUTANOL DEHYDROGENASE; 32: 1vlj-B 34.4 2.9 333 400 20 PDB MOLECULE: NADH-DEPENDENT BUTANOL DEHYDROGENASE; 33: 1oj7-A 33.9 2.8 327 390 17 PDB MOLECULE: HYPOTHETICAL OXIDOREDUCTASE YQHD; 34: 1oj7-B 33.9 2.7 328 390 17 PDB MOLECULE: HYPOTHETICAL OXIDOREDUCTASE YQHD; 35: 3jzd-A 33.8 2.9 314 354 17 PDB MOLECULE: IRON-CONTAINING ALCOHOL DEHYDROGENASE; 36: 1oj7-D 33.8 2.8 329 390 17 PDB MOLECULE: HYPOTHETICAL OXIDOREDUCTASE YQHD; 37: 3jzd-D 33.8 2.9 315 354 17 PDB MOLECULE: IRON-CONTAINING ALCOHOL DEHYDROGENASE; 38: 3iv7-A 33.6 2.9 314 356 21 PDB MOLECULE: ALCOHOL DEHYDROGENASE IV; 39: 3jzd-C 33.5 2.9 315 354 17 PDB MOLECULE: IRON-CONTAINING ALCOHOL DEHYDROGENASE; 40: 3jzd-B 33.4 2.8 312 354 17 PDB MOLECULE: IRON-CONTAINING ALCOHOL DEHYDROGENASE; 41: 3hl0-A 33.1 3.1 315 351 16 PDB MOLECULE: MALEYLACETATE REDUCTASE; 42: 3iv7-B 32.8 3.1 314 356 21 PDB MOLECULE: ALCOHOL DEHYDROGENASE IV; 43: 3hl0-B 31.2 3.2 312 350 16 PDB MOLECULE: MALEYLACETATE REDUCTASE; 44: 1jq5-A 30.8 3.1 317 366 20 PDB MOLECULE: GLYCEROL DEHYDROGENASE; 45: 1kq3-A 29.0 3.7 318 364 20 PDB MOLECULE: GLYCEROL DEHYDROGENASE; 46: 1jpu-A 29.0 3.3 313 361 19 PDB MOLECULE: GLYCEROL DEHYDROGENASE; 47: 1jqa-A 28.8 3.3 314 361 19 PDB MOLECULE: GLYCEROL DEHYDROGENASE; 48: 1ta9-B 28.4 3.5 316 394 17 PDB MOLECULE: GLYCEROL DEHYDROGENASE; 49: 1ta9-A 28.1 3.5 313 389 17 PDB MOLECULE: GLYCEROL DEHYDROGENASE; 50: 1oj7-C 28.1 3.4 326 390 17 PDB MOLECULE: HYPOTHETICAL OXIDOREDUCTASE YQHD; 51: 3ce9-A 26.8 3.5 299 349 14 PDB MOLECULE: GLYCEROL DEHYDROGENASE; 52: 3ce9-D 26.8 3.7 306 349 16 PDB MOLECULE: GLYCEROL DEHYDROGENASE; 53: 3ce9-B 26.7 3.7 306 348 16 PDB MOLECULE: GLYCEROL DEHYDROGENASE; 54: 3ce9-C 26.6 3.6 305 349 16 PDB MOLECULE: GLYCEROL DEHYDROGENASE; 55: 1xag-A 24.4 3.1 293 353 14 PDB MOLECULE: 3-DEHYDROQUINATE SYNTHASE; 56: 1dqs-B 24.2 3.1 290 380 13 PDB MOLECULE: PROTEIN (3-DEHYDROQUINATE SYNTHASE); 57: 1dqs-A 24.1 3.2 294 381 13 PDB MOLECULE: PROTEIN (3-DEHYDROQUINATE SYNTHASE); 58: 1nvf-B 24.0 3.1 292 387 13 PDB MOLECULE: 3-DEHYDROQUINATE SYNTHASE; 59: 1nr5-B 23.9 3.2 291 390 13 PDB MOLECULE: 3-DEHYDROQUINATE SYNTHASE; 60: 1nvf-A 23.9 3.2 292 387 13 PDB MOLECULE: 3-DEHYDROQUINATE SYNTHASE;

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
     dimer_MH.png
    No description
    319.62 kB03:01, 19 Jan 2010gyewonActions
     monomer_MH.png
    No description
    289.96 kB03:01, 19 Jan 2010gyewonActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch