.
The Open Protein Structure Annotation Network
PDB Keyword
.

3qwn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Hypothetical nigD-like protein (BACCAC_03262) from Bacteroides caccae at 2.42 A resolution. To be published
    Site JCSG
    PDB Id 3qwn Target Id 416602
    Molecular Characteristics
    Source Bacteroides caccae atcc 43185
    Alias Ids TPS33798,ZP_01961629.1, 327408 Molecular Weight 23760.15 Da.
    Residues 213 Isoelectric Point 4.91
    Sequence eddyyypsvklefvtvkagtdgsiqtlipdngealtvskdrtgsaispntsrrvmsnyetlsnghtata viyslqslvtptpkpaddptyrdglkhdpvdvvsiwlgrgylnmilnlkvnggkqhvfgivedlsefet ngtvnmllyhdangdeeyynrraylsvpldkyadaenpgqkitikfkyytydkdgtaiesgkycnpgfe yvpdkn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 12
    Resolution (Å) 2.42 Rfree 0.2131
    Matthews' coefficent 2.87 Rfactor 0.1754
    Waters 1222 Solvent Content 57.12

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3qwn

    Protein Summary

    Similar to other jcsg structures, 3k6o, 3k0y and 3nqi.

     

    The oligomer from crystal is a tetramer, while experimental results suggested a monomer in solution.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     sp13895a-tetramer.png
    SP13895a tetramer
    159.13 kB19:27, 14 Feb 2011qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch