The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Hypothetical DinB-like protein (CPS_3021) from Colwellia psychrerythraea 34H at 2.20 A resolution. To be published
    Site JCSG
    PDB Id 3qth Target Id 401373
    Molecular Characteristics
    Source Colwellia psychrerythraea 34h
    Alias Ids TPS30614,YP_269720.1, BIG_238, BIG_417 Molecular Weight 19910.77 Da.
    Residues 175 Isoelectric Point 5.20
    Sequence mlsridlyikhrdiflkhlellhkliekvedsslnesellnarlvddmfpfnvqakiatnfalraccpl sgkeykelegdidsfcglktyvvtaidyinklseptleqlnlnvqdtagfkeismpaseymssfvlpnf ffhismvyaiaknngvsvtkgdfdgihqypkgfswea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.2089
    Matthews' coefficent 2.45 Rfactor 0.1817
    Waters 88 Solvent Content 49.80

    Ligand Information


    Google Scholar output for 3qth

    Protein Summary

    Pfam Update:  This sequence hits DUF1993 with high significance. There is already one structure, 2oqm, for this family which has allowed us to put it into the: DinB (CL0310) clan. I will close this ticket now.


    The structure of target ID 401373 was determined by Se-SAD at a wavelength of 2.2 Ang. The sequence of this target belongs to the DUF1993 PF09351 Pfam Family. This family is functionally uncharacterized, but is represented by one previously determined  JCSG structure, PDB ID 2OQM




    Shown above is a ribbons representation of the structure of the monomer of target id 401373 color coded with the N-terminal end in blue and the C-terminal end in red.



    Based on crystal packing, the dimeric form of the protein is likely to be a significant oligomerization state. Shown below is a ribbons representation of the dimer with the individual subunits colored in green and cyan.



     Shown below is a superpositioning of the structure of target id 401373 (green) and PDB ID 2oqm (yellow). (DALI Z-score 20.7, length of alignment 164 residues, rmsd overlap=2.2 Angstroms, sequence id=23%).


    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (3)

    FileSizeDateAttached by 
    No description
    167.42 kB21:48, 15 Feb 2011haxelrodActions
    No description
    120.65 kB21:48, 15 Feb 2011haxelrodActions
    No description
    243.05 kB22:15, 15 Feb 2011haxelrodActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch