.
The Open Protein Structure Annotation Network
PDB Keyword
.

3qta

    Title Crystal structure of a Hypothetical CheC-like protein (rrnAC0528) from HALOARCULA MARISMORTUI ATCC 43049 at 2.00 A resolution. To be published
    Site JCSG
    PDB Id 3qta Target Id 403041
    Molecular Characteristics
    Source Haloarcula marismortui atcc 43049
    Alias Ids TPS30770,YP_135254.1, _0038.001290_, 322417 Molecular Weight 25043.63 Da.
    Residues 232 Isoelectric Point 4.08
    Sequence mpllidirkltlitrliqdgaeqvadslatlagvdaaveikslsfvqpediatemgggtiysarvrlte ppygvflmtfetetaaeiaelmtgssvedgftqlhesalqemcniltsgfidgiantlnatinmgtptv vqddateiadkalshvrrdsltivldslvdikesdvafslriflipdpgsfvhlidqldydtdrethis adtdavkeldmsgdadaldafdssk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.2023
    Matthews' coefficent 2.95 Rfactor 0.1748
    Waters 326 Solvent Content 58.24

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3qta

    Protein Summary

    It is likely to be a putative cheC/fliM- like protein

    Sequence analysis:
    HHpred, against pfam, top hit CheC-like family (PF04509, Prob 99.1, E-value 1.1E-11, P-value 9E-16), 2nd hit Flagellar motor switch
    protein FliM (PF02154, Prob 98.7, E-value 5.1E-07, P-value 4.3E-11) FFAS, againt pfam, Flagellar motor switch protein FliM (PF02154, score -21.700), 2nd hit CheC-like family (PF04509, score -17.000)

    Structural analysis:
    Dali, against PDB, top hit CHEMOTAXIS PROTEIN CHEC (PDB 1xkr-A, Z-score 21.2, rmsd 2.8, lali 195), 2nd hit CHEMOTAXIS PROTEIN CHEC (PDB 2f9z-A, z-score 19.5, rmsd 2.8, lali 184). 3rd hit FLAGELLAR MOTOR SWITCH PROTEIN FLIM (PDB 2hp7-A, Z-score 15.6, rmsd 3.1, lali 169)
     
    Note that CheC and FliM share a very similar topology. However, Flim lacks the phosphatase consensus motif present in CheC. A further analysis should be performed to discriminate between these two proteins.

    YP_135254.1 belongs to PFAM PF04509 CheC.

    The monomer and dimer structures are shown below.

    MJ11052C_mon.png  MJ11052C_dimer.png

    The top DALI hits are summarized in the table below.

    Top 10 DALI Structural Homologs
    N PDB Z-score RMSD LALI NRES %ID Description (JCSG structures highlighted in red)
    1 1xkr 21.2 2.8 195 205 18 Chemotaxis Protein Chec
    2 2f9z 19.5 2.8 184 193 18 Chemotaxis Protein Chec
    3 2hp7 15.6 3.1 169 179 7 Flagellar Motor Switch Protein Flim
    4 1xko 12.0 2.8 144 159 16 Chemotaxis Protein Chex
    5 1squ 11.8 2.9 142 154 15 Chex Protein
    6 3h4y 11.1 3.1 145 154 12 Putative Chemotaxis Protein
    7 3hm4 10.9 3.1 145 150 16 Chemotaxis Protein Chex
    8 3iic 10.6 3.2 144 154 18 Chec Domain Protein
    9 3hzh 10.6 3.6 147 154 14 Chemotaxis Response Regulator (chey-3)
    10 3h2d 9.6 3.7 144 154 15 Chec-like Superfamily Protein

    A superposition of YP_135254.1 onto the first two DALI hits lends support to the assignment of this protein to be CheC.

    MJ11052c_1xkr_2f9z.png

    Color Scheme: YP_135254.1 (green), 1xkr (blue), 2f9z (magenta)
     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch