.
The Open Protein Structure Annotation Network
PDB Keyword
.

3qbm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a TetR transcriptional regulator (Caur_2221) from CHLOROFLEXUS AURANTIACUS J-10-FL at 1.80 A resolution. To be published
    Site JCSG
    PDB Id 3qbm Target Id 399264
    Molecular Characteristics
    Source Chloroflexus aurantiacus j-10-fl
    Alias Ids TPS29702,YP_001635819.1, _0052.002647_, _0114.002261_, _0076.003088_, _0111.000795_, _0090.002210_, _0081.003627_, 327917 Molecular Weight 21864.87 Da.
    Residues 198 Isoelectric Point 5.98
    Sequence mrkgqetrervvaqaaalfnvsgyagtaisdimaatglekggiyrhfeskeqlalaafdyaaekvrerf avglaghkhtvdtiiafldvfrsyaerpplvggcpilntaiesddtnpmlrervravidewretirtlv qtgiargeirpevdadrlalliiatmegavmlariletatplehaythlatyitqqvrla
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.2132
    Matthews' coefficent 2.21 Rfactor 0.1647
    Waters 321 Solvent Content 44.41

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3qbm

    Protein Summary

    This protein has the structure of a TetR family transcription factor (Pfam PF00440).

    It is present as a dimer:

    Fig1.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     Fig1.png
    No description
    460.16 kB19:51, 12 Oct 2010debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch