.
The Open Protein Structure Annotation Network
PDB Keyword
.

3q1n

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a galactose mutarotase-like protein (LSEI_2598) from Lactobacillus casei ATCC 334 at 1.61 A resolution. To be published
    Site JCSG
    PDB Id 3q1n Target Id 398487
    Molecular Characteristics
    Source Lactobacillus casei atcc 334
    Alias Ids TPS30560,LCAS_20SEP02_SCAFFOLD13_REVISED_GENE898, _0116.000991_, 327185 Molecular Weight 32392.41 Da.
    Residues 293 Isoelectric Point 5.05
    Sequence litienskfkagiaergaelqslvnkadnyeyvwtgdktfwnrhapilfpsigksnqdqyrlgaktypm sqhgfardydfdvsdksdsavtftqhqnaetlkkfpfeytlavtymltdgglsvhytvtnddsksmpfa lgfhpafnvglkadgsfddydltveplnsplqrfgigpvpfrngdvedipgaegnrlplthdlldgglv ilanseiakatlasphhdhsitldisdfpyltiwspehkkapfiavepfdglpdqageptdwytklgnt tlsagankqlalkvelh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.61 Rfree 0.182
    Matthews' coefficent 2.37 Rfactor 0.155
    Waters 333 Solvent Content 48.09

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3q1n

    Protein Summary

    The structure of target ID 398487 has been determined by three wavelength Se-MAD to a wavelength of 1.61 Angstroms. The structure belongs to the Aldose-1-epimerase Pfam class (PF01263), and 61 structures have been determined for this Pfam class. Shown below is a ribbons representation of the structure of target ID 398487 color coded with the N-terminal end in blue and the C-terminal end in red.monomer.png

     

     A DALI search shows that the structure of target ID 398487 is similar to the following structures:

    PDB ID DALI Z-Score rmsd overlap (Angstroms) length of algnment number residues in hit % sequence identity description
    3dcd 39.3 1.9 289 300 29% galactose mutarotase related enzyme Q5FKD7 from Lactobacillus acidophilus at the resolution 1.9 Angstrom. Northeast structural genomics consortium target LaR33.
    3k25  30.4  2.1  259  289  21%  Slr1438 protein from Synechocystis sp. PCC 6803, Northeast Structural Genomics Consortium target SgR112.
    2cis  27.1  2.3  246  288  20%  Structral based functional annotation: Yeast YMR099C codes for a D-hexose-6-phosphate mutorotase.
    1lur  25.8  2.6  266  325  17% GalM/aldolase epimerase homolog from C. elegans, Northeast Structual Genomics Target WR66.
    1yga  25.2  2.7  263  336  16 Saccharomyces cerevisiae YN9A protein, New York Structural Genomics Consortium
    3imh  24.9  2.7  260  332  17 Galactose-1-epimerase from Lactobacillus acidophilus.
    2hta  24.9  2.5  239  297  18 Putative mutarotase YeaD from Salmonella typhimurium in orthorhombic form.
    1z45  24.6  2.6  263  674  14  Gal10 fusion protein galactose mutarotase/UDP galactose-4-epimerase from Saccharomyces cerevisiae complexed with NAD, UDP-glucose, and galactose.
    1snz  24.6  2.7  265  342  16  apo human galactose mutarotase
    1nsu  24.0  2.7  263  339  20  galactose mutarotase from Lactococcus lactis mutant H96N  complexed with galactose.
    1mmu  23.9  2.6  262  339  20 galactose mutarotase from Lactococcus lactis from complexed with glucose.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     monomer.png
    No description
    209.42 kB19:50, 3 Apr 2010haxelrodActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch