The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an aspartate transaminase (NCgl0237, Cgl0240) from CORYNEBACTERIUM GLUTAMICUM ATCC 13032 KITASATO at 1.25 A resolution. To be published
    Site JCSG
    PDB Id 3ppl Target Id 390716
    Molecular Characteristics
    Source Corynebacterium glutamicum atcc 13032
    Alias Ids TPS14607,NP_599493.1, 3.40.640.10, 85724 Molecular Weight 46516.09 Da.
    Residues 426 Isoelectric Point 4.85
    Sequence mssvslqdfdaeriglfhedikrkfdelksknlkldltrgkpsseqldfadellalpgkgdfkaadgtd vrnyggldgivdirqiwadllgvpveqvlagdasslnimfdviswsyifgnndsvqpwskeetvkwicp vpgydrhfsiterfgfemisvpmnedgpdmdaveelvknpqvkgmwvvpvfsnptgftvtedvakrlsa metaapdfrvvwdnayavhtltdefpevidivglgeaagnpnrfwaftstskitlagagvsffltsaen rkwytghagirgigpnkvnqlaharyfgdaegvravmrkhaaslapkfnkvleildsrlaeygvaqwtv paggyfisldvvpgtasrvaelakeagialtgagssyplrqdpenknlrlapslppveelevamdgvat cvllaaaehyan
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.25 Rfree 0.1242
    Matthews' coefficent 2.44 Rfactor 0.1049
    Waters 1281 Solvent Content 49.63

    Ligand Information


    Google Scholar output for 3ppl

    Protein Summary

     Pfam note: this protein falls into our new family Aminotran_MocR, PF12897


    The NP_599493 protein contains 426 residues from Corynebacterium glutamicum atcc 13032 kitasato with a calculated isoelectric point of 4.85. The crystal structural was determined at 1.30 Å resolution. Both sequence alignment and structural homolog search by Dali and SSM suggests this protein be an aspartate transaminase with conserved active site. Pyridoxal 5'-phosphate (PLP) molecules from bacterial natural processing have been indentified and modeled in the structure near Lys 259.  An unknown ligand (UNL) is bound near the PLP. The biomolecule is a dimer.



    Fig. 1   The monomer of protein NP_599493 complex with PLP.




    Fig. 2   The biomolecule of protein NP_599493 is a dimer.

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
    No description
    1422.38 kB00:13, 3 Jun 2010kevinjinActions
    No description
    1558.02 kB00:13, 3 Jun 2010kevinjinActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch