The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative transcription regulator (R01717) from Sinorhizobium meliloti 1021 at 1.55 A resolution. To be published
    Site JCSG
    PDB Id 3pjy Target Id 405915
    Molecular Characteristics
    Source Sinorhizobium meliloti 1021
    Alias Ids TPS33730,NP_385823.1, PF02643, 322989 Molecular Weight 15065.44 Da.
    Residues 135 Isoelectric Point 6.10
    Sequence evsyakervrlitasgrthdltvelavdpsqreqglmyrrqmapdhgmlfdfgetrpvmmwmkntylpl dmlfiasdgtirtihenavphseaiidsrepvayvlelnagtvkrlgvspgdrlegaglpatkran
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.55 Rfree 0.1903
    Matthews' coefficent 2.50 Rfactor 0.1611
    Waters 282 Solvent Content 50.85

    Ligand Information


    Google Scholar output for 3pjy

    Protein Summary

    Gene SMc00288 (NP_385823) from legume symbiont bacteria Sinorhizobium meliloti 1021 encodes a predicted secreted protein with 163 residues. The 135 amino acid construct, with a removed (predicted) signaling peptide was solved by JCSG.   This protein is a second member of PFAM family PF02643 (DUF192, PFAM:PF02643), solved by JCSG, the first being  being 3m7a. DUF192 is a large (>500 members) and broadly distributed family of bacterial proteins, present mostly in environmental bacteria and metagenomes (distant homologs are also present in several Plasmodium species).


    Dali search and SSM alignment find only its homolog (PDB:3M7A), solved previously by JCSG and annotated as having unknown function. Distant structural similarity and genome context and gene fusion analysis suggests possible involvement in sugar metabolism as an auxiliary substrate binding domain, see the discussion on the TOPSAN 3m7a page http://www.topsan.org/Proteins/JCSG/3m7a



    Figure 1. The monomer of protein NP_385823



    Figure 2. There are two molecules in each asymetric unit cell.

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
    No description
    367.98 kB21:05, 14 Jun 2010kevinjinActions
    No description
    404.46 kB21:05, 14 Jun 2010kevinjinActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch