.
The Open Protein Structure Annotation Network
PDB Keyword
.

3pet

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative adhesin (BF0245) from Bacteroides fragilis NCTC 9343 at 2.07 A resolution. To be published
    Site JCSG
    PDB Id 3pet Target Id 386554
    Molecular Characteristics
    Source Bacteroides fragilis nctc 9343
    Alias Ids TPS33693,YP_209941.1, 333115 Molecular Weight 23269.30 Da.
    Residues 220 Isoelectric Point 9.18
    Sequence gegiqpskklitrdykvkefnkidagtvgniyytqstdgktdlqiygpdnivaliqvavkdntlflsid kskkvrnfkkmkititsptlngisfkgvgdvhienglttdnldieskgvgnvdiqsltcqklnvqsmgv gdvklegtaqiaalhskgvgnieagnlranaveassqgvgditcnatesidaavrgvgsikykgsptik slskkgvgtikni
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.07 Rfree 0.2102
    Matthews' coefficent 2.56 Rfactor 0.1758
    Waters 306 Solvent Content 51.97

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3pet
    1. Lipase from Thermomyces lanuginosus: Uses and prospects as an industrial biocatalyst
    R Fernandez-Lafuente - Journal of Molecular Catalysis B: Enzymatic, 2010 - Elsevier
     
    2. Enzymatic surface hydrolysis of PET: effect of structural diversity on kinetic properties of cutinases from Thermobifida
    E Herrero Acero, D Ribitsch, G Steinkellner - , 2011 - ACS Publications
     
    3. DotU and VgrG, Core Components of Type VI Secretion Systems, Are Essential for Francisella LVS Pathogenicity
    JE Brms, L Meyer, M Lavander, P Larsson, A Sjstedt - PloS one, 2012 - dx.plos.org
     

    Protein Summary

    This is the 4th homologous structure of an beta-helix fold, similar in structure to 3jx83lyc, and 3ljy. These structures will be analyzed together. A member of DUF2807, which may be involved in cell adhesion.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch