.
The Open Protein Structure Annotation Network
PDB Keyword
.

3p6l

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Sugar phosphate isomerase/epimerase (BDI_1903) from Parabacteroides distasonis ATCC 8503 at 1.85 A resolution. To be published
    Site JCSG
    PDB Id 3p6l Target Id 396614
    Molecular Characteristics
    Source Parabacteroides distasonis atcc 8503
    Alias Ids TPS27944,YP_001303260.1, 333081 Molecular Weight 29892.66 Da.
    Residues 261 Isoelectric Point 7.19
    Sequence qtkaekngwrlgmqsysfhlfpltealdktqelglkyieiypghklggkwgdkvfdfnldaqtqkeike laaskgikivgtgvyvaekssdwekmfkfakamdlefitcepalsdwdlveklskqynikisvhnhpqp sdywkpenllkaisgrsqslgscsdvghwrreglnqidclkqlkgriislhfkdiapkkageneqhdvi wgtgildvkgmlkelksqnfkgvfsieyeynwensvpdikeciqyfnktaneil
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.2385
    Matthews' coefficent 2.30 Rfactor 0.1862
    Waters 180 Solvent Content 46.54

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3p6l

    Protein Summary

    This protein from Parabacteroides distasonis atcc 8503 is annotated as a member of PFAM:PF01261, the xylose isomerase-like TIM barrel proteins of AP_endonuclease_2 family. 

    The protein is present as a monomer in the crystal structure:

    Fig1.png

    Phosphate, PEG and Citrate from the crystallization solution have been modeled in the solvent structure. The citrate molecule is surrounded by histidines, asparates, a glutamine and tyrosine residues.

    Crystal packing analysis suggests that that the bound phosphate mediates a dimer packing in the crystal structure:

    Fig2.png

    JCSG has also solved the structure of another homolog from the same organism with 22% sequence id, PDB:3lmz and its description can be found in its TOPSAN page.

    The 3lmz protein (cyan) also has a citrate molecule at the same site as this protein (red):

    Fig3.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (3)

    FileSizeDateAttached by 
     Fig1.png
    No description
    423.5 kB17:28, 27 Sep 2010debanuActions
     Fig2.png
    No description
    119.15 kB17:49, 27 Sep 2010debanuActions
     Fig3.png
    No description
    456.15 kB18:13, 27 Sep 2010debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch