.
The Open Protein Structure Annotation Network
PDB Keyword
.

3p69

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hypothetical protein (BF4250) from Bacteroides fragilis NCTC 9343 at 2.05 A resolution. To be published
    Site JCSG
    PDB Id 3p69 Target Id 416701
    Related PDB Ids 3owr 
    Molecular Characteristics
    Source Bacteroides fragilis nctc 9343
    Alias Ids TPS33811,YP_213812.1, 327325 Molecular Weight 14473.47 Da.
    Residues 133 Isoelectric Point 5.91
    Sequence skedlpayeeaeitkvgayhrfysgdkdaitgenivaekeldrtnnidsehgvatavftipaaggkfte aerakvslsnlvvyvnvstaarvtpldgspkfgvpadwtrehkysvmaadgtkkiwtvkvtlnk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.05 Rfree 0.2194
    Matthews' coefficent 4.01 Rfactor 0.1893
    Waters 267 Solvent Content 69.31

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3p69

    Protein Summary

    This sequence hits nothing in Pfam, so it might be very interesting. I will build a family from it and see what that matches, if anything.
    Update: This builds to a family that overlaps with:
    ID Xylanase
    AC PF13201
    DE Putative glycoside hydrolase xylanase
    This sequence hits nothing in Pfam, so it might be very interesting. I will build a family from it and see what that matches, if anything.

     

     

    Target ID 416701 belongs to an uncharacterized Pfam class, and its structure is reported here to a resolution of 1.81 Ang from a tetragonal P4 crystal form.

     

    monomer.png

    Shown here is a ribbons representation of the structure of target ID 416701 color coded with the N-terminal end in blue and the C-terminal end in red.

     

     

     

     

     

     

     

     

     

     

     

    The results of a DALI search show that target ID 416701 shows some structural similarity to another JCSG target, PDB ID 3hbz.

     

    PDB ID
    DALI Z-SCore
    rmsd overlap (Ang)
    alignment length
    number of residues in related target
    % sequence id
    Description
    Citation
    3hbz_A 10.7 2.4 85 341 25 Crystal structure of putative glycoside hydrolase (NP_810994.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.05 A resolution

    JCSG

    doi:10.1107/S1744309110028228
     

    2oz4_A 5.3 3.8 69 265 6 Structural Plasticity in IgSF Domain 4 of ICAM-1 Mediates Cell Surface Dimerization [Ref]
    2zwk_A 4.5 3.0 73 183 14 Crystal structure of intimin-Tir90 complex  
    2wcp_A 4.3 4.0 73 208 7 CRYSTAL STRUCTURE OF MOUSE CADHERIN-23 EC1-2  

     

     

    3hbz_to_SP16654A.png

    Shown to the left is a comparison of the structures of target ID 416701(blue) and PDB ID 3hbz (orange).

     

     

     

     

     

     

    Ligand Summary

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
     3hbz_to_SP16654A.png
    No description
    150.77 kB01:38, 11 Sep 2010haxelrodActions
     monomer.png
    No description
    102.21 kB20:00, 2 Sep 2010haxelrodActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch