.
The Open Protein Structure Annotation Network
PDB Keyword
.

3p3v

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a PTS dependent N-acetyl-galactosamine-IIB component (agaV, SPy_0631) from Streptococcus pyogenes at 1.65 A resolution. To be published
    Site JCSG
    PDB Id 3p3v Target Id 399539
    Molecular Characteristics
    Source Streptococcus pyogenes m1 gas
    Alias Ids TPS29740,NP_268878.1, _0035.002091_, 324900 Molecular Weight 17872.68 Da.
    Residues 162 Isoelectric Point 6.03
    Sequence mtqpniimtrvderlihgqgqlwvkflncntvivandavsedkiqqslmktvipssiairffsiqkvid iihkaspaqsifivvkdlqdakllveggvpiteinignihktddkvaitqfislgetdksairclahdh hvvfntkttpagnsasdvdildyi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.65 Rfree 0.1939
    Matthews' coefficent 2.14 Rfactor 0.1584
    Waters 301 Solvent Content 42.53

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3p3v

    Protein Summary

    This protein is annotated as a putative PTS dependent N-acetyl-galactosamine-IIB component (EC:2.7.1.-, putatively EC:2.7.1.59) from Streptococcus pyogenes belonging to PFAM:PF03830

    It is present as a monomer in the crystal structure and analytical size-exclusion chromatography supports a monomer as the significant oligomeric state in solution.

    Fig1.png

    The structures of several other similar proteins are available ranging from 25-33% sequence identity with PDB ids PDB:1nrz, PDB:3eye, PDB:1ble and PDB:2jzh.

    There are some differences between the monomers in the ASU in addition to differences in the loop regions:
    like the backbone flip near residue 18, e.g. O from residue 18 interacts with Arg-10 in the B-chain while in the A chain O from residue 18 interacts with backbone N from residue 21.
     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     Fig1.png
    No description
    345.39 kB23:20, 30 Sep 2010debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch