.
The Open Protein Structure Annotation Network
PDB Keyword
.

3p02

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a protein of unknown function (BACOVA_00267) from Bacteroides ovatus at 1.55 A resolution. To be published
    Site JCSG
    PDB Id 3p02 Target Id 416719
    Molecular Characteristics
    Source Bacteroides ovatus atcc 8483
    Alias Ids TPS33819,ZP_02063322.1, 333108 Molecular Weight 36481.84 Da.
    Residues 316 Isoelectric Point 4.93
    Sequence dewtdeqfkqlisfktqpggwgvtdvhvryansakytynlpvlvsgstdntddrlvsfslrddtldiln fekfgnrpelyfrelpqkyysfpkeltipagqshallpiefsldglddsqkwalplkvcedangtyavn prkyyrtavlrpilfnefsgrfsgssllgtmagesdikfssteiklnvvtdsivffyagqrtedyedri nykvflqftgdkvdskkdlykmkiwaeneklkfnsystptykvssemdatktylkhtyivisdidfdfv dytsvpnyeieynmkgglsvsrdldtrkpdedqgsdskww
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.55 Rfree 0.1900
    Matthews' coefficent 2.10 Rfactor 0.1646
    Waters 489 Solvent Content 41.43

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3p02

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch