The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a SusD superfamily protein (BDI_3964) from Parabacteroides distasonis ATCC 8503 at 1.95 A resolution. To be published
    Site JCSG
    PDB Id 3otn Target Id 396627
    Molecular Characteristics
    Source Parabacteroides distasonis atcc 8503
    Alias Ids TPS27960,YP_001305260.1, BIG_773, 327006 Molecular Weight 55158.13 Da.
    Residues 481 Isoelectric Point 4.96
    Sequence qptgtmttdskltskesalaltnsaylkntvfnkmtpgwgcntillleymtgkatsensqsnykdfqdl lvsdrslyiedwwqdcyagiancnlalqklgefenldaslvngymaevkfmralyyfylvrifgdvpki ttvqselgelqvsrapvkeiydeiiipdlleaeqsdlafsdhtgrvsmgavkalladvyltyagyplqg gksyyaesakrsleviksneytlftdyeslrlpsqnnkgefiyqvqfslnkrhnesvriflpsrsgisa ydleygsliptkefvesfekgdkrteekqyfftnykghpskfspgaaelefmdlngyyiykffdqvavd ntaksdlnwsvyrytdvllmyaeaqvnadgtpnqqsidivnqirgraglapfkqtnasafleevwdqry fdlcyenkmwfdmlrtrkirddksgeyvdfigyktnwgkvytetqllfpiplserqanpnltqnqgy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.95 Rfree 0.1906
    Matthews' coefficent 2.36 Rfactor 0.1436
    Waters 869 Solvent Content 47.83

    Ligand Information


    Google Scholar output for 3otn

    Protein Summary

    This protein is annotated as a putative outer membrane protein that is likely involved in nutrient binding. It has been classified in the PFam family SusD_RagB/PF07980.

    It is a dimer in the crystal structure:


    JCSG has solved numerous structures from this PFam family including the PDB ids 3myv, 3mcx, 3lew, 3l22, 3kez, 3jys, 3jq0, 3jq1, 3iv0, 3ihv, 3i4g, 3hdx.

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
    No description
    477.48 kB00:29, 6 Aug 2010debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch