.
The Open Protein Structure Annotation Network
PDB Keyword
.

3oql

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a TenA homolog (PSPTO1738) from Pseudomonas syringae pv. tomato str. DC3000 at 2.54 A resolution. To be published
    Site JCSG
    PDB Id 3oql Target Id 403252
    Molecular Characteristics
    Source Pseudomonas syringae pv. tomato str. dc3000
    Alias Ids TPS31014,NP_791563.1, _0071.000531_, 322321 Molecular Weight 29986.76 Da.
    Residues 261 Isoelectric Point 6.15
    Sequence midtfertgplmeassypawaqqlindcspakarvvehelyqqmrdaklspqimrqyliggwpvveqfa vymaknltktrfgrhpgedmarrwlmrnirvelnhadywvnwcaahdvtledlhdqrvapelhalshwc wqtsssdslavamaatnyaiegatgewsavvcstgvyaeafaeetrkksmkwlkmhaqyddahpweale iictlvgnkpslqlqaelrqavtksydymylflerciqldkvksprgrvaalem
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.54 Rfree 0.2016
    Matthews' coefficent 2.22 Rfactor 0.1764
    Waters 57 Solvent Content 44.48

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3oql
    1. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     

    Protein Summary

    Pfam update:  This sequence hits family TENA_THI-4 (PF03070). There are many other structures in this family.

    The original annotation for this target was conserved hypothetical protein of unknown function.

    It is present as a tetramer in the crystal structure:

    Fig1.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     Fig1.png
    No description
    449.9 kB22:24, 22 Jul 2010debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch