.
The Open Protein Structure Annotation Network
PDB Keyword
.

3op7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a PLP-dependent aminotransferase (ZP_03625122.1) from Streptococcus suis 89-1591 at 1.70 A resolution. To be published
    Site JCSG
    PDB Id 3op7 Target Id 391485
    Related PDB Ids 3p6k 
    Molecular Characteristics
    Source Streptococcus suis 98hah33
    Alias Ids TPS20893,SSUI_28JUL04_CONTIG216_REVISED_GENE695, 3.40.640.10, 384320 Molecular Weight 42433.13 Da.
    Residues 374 Isoelectric Point 4.66
    Sequence mklprfgveewlnvhensaiydiagvsissltleelfalsgtnpedfykklqgtklnygwiegspafkk svsqlytgvkpeqilqtngatganllvlysliepgdhvislyptyqqlydipkslgaevdlwqieeeng wlpdleklrqlirpttkmicinnannptgavmdrtyleelveiasevgayilsdevyrsfseldvpsii evydkgiavnslsktyslpgirigwvaanhqvtdilrdyrdytmicagvfddlvaqlalahyqeilern rhileenlaildqwieeeplvsyirpavvstsfvkiavdmpmedfclqllqehgvllvpgnrferdgyv rlgfaceqetlikgleklsqflrrfdken
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.1974
    Matthews' coefficent 2.46 Rfactor 0.1636
    Waters 278 Solvent Content 50.10

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3op7

    Protein Summary

    The protein ZP_03625122.1 is an aminotransferase. It belongs to PFAM PFAM:PF00155. There are many structures reported in this family.

     

    The monomer structure is shown below.

    mol.png

     

    The residue Lysine 221 is covalently attached to PLP and modeled as LLP as shown above in cyan stick representation.

    Near the LLP is modeled an unknown ligand (UNL) that resembles Pyridoxamine. A zoomed view is shown below.

    unl.png

    A 2FoFc density contoured at 1 sigma above mean has been shown around the UNL.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (2)

    FileSizeDateAttached by 
     mol.png
    No description
    153.27 kB19:50, 27 Aug 2010abhinavkActions
     unl.png
    No description
    208.5 kB19:50, 27 Aug 2010abhinavkActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch