.
The Open Protein Structure Annotation Network
PDB Keyword
.

3op6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an oligo-nucleotide binding protein (lpg1207) from Legionella pneumophila subsp. pneumophila str. philadelphia 1 at 2.00 A resolution. To be published
    Site JCSG
    PDB Id 3op6 Target Id 403115
    Molecular Characteristics
    Source Legionella pneumophila subsp. pneumophila str. philadelphia 1
    Alias Ids TPS31006,YP_095238.1, _0014.003584_, 322338 Molecular Weight 16408.25 Da.
    Residues 151 Isoelectric Point 6.51
    Sequence mpvkklkqfldshkikylsiahspaytaqeiaasahvsgkqlaktviikmdgrlamvvlpasdhitfmk lkeaigtsdlelatesefegkfaecdvgamppfgnlyglpvlvstklsaqdnilfnagshselmqlsfg dfeklvkptlvtl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.2308
    Matthews' coefficent 2.18 Rfactor 0.1951
    Waters 169 Solvent Content 43.68

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3op6

    Protein Summary

    Pfam update: This protein matches the Pfam entry Ybak (PF04073)

    This protein is present as a dimer in the crystal structure. Analytical SEC supports the assignment of a dimer as the significant oligomeric form in solution:

    Fig1.png

    FFAS (link above) indicates strong similarities cysteinyl-tRNA(Pro) deacylase, trans-editing enzyme and YbaK protein wth PDB ids 1dbu, 2cx5 and 3dxa. The JCSG has also solved 2 similar structures (only ~15% sequence identity to this target) with PDB ids 1vjf and 1vki.

    All the above structures have been solved by structural genomics centers.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     Fig1.png
    No description
    378.72 kB23:12, 20 Jul 2010debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch