.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ohe

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Histidine triad protein (Maqu_1709) from Marinobacter aquaeolei VT8 at 1.20 A resolution. To be published
    Site JCSG
    PDB Id 3ohe Target Id 403209
    Molecular Characteristics
    Source Marinobacter aquaeolei vt8
    Alias Ids TPS30650,YP_958980.1, _0064.001425_, 324411 Molecular Weight 15464.08 Da.
    Residues 136 Isoelectric Point 5.46
    Sequence mfqlherlaadthklgesrlcdvllmndntwpwvilvprvsgireiyelpneqqqrllfessalsegmm elfggdkmnvaalgnmvpqlhlhhivryqgdpawpgpvwgkqppvpyteeqqasvkaklqplleqla
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.20 Rfree 0.1535
    Matthews' coefficent 2.28 Rfactor 0.1281
    Waters 437 Solvent Content 46.01

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3ohe

    Protein Summary

     HIT family. H90 is expected to be catalytic

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch