.
The Open Protein Structure Annotation Network
PDB Keyword
.

3nwp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a 6-phosphogluconolactonase (Sbal_2240) from Shewanella baltica OS155 at 1.40 A resolution. To be published
    Site JCSG
    PDB Id 3nwp Target Id 398981
    Molecular Characteristics
    Source Shewanella baltica os155
    Alias Ids TPS30577,YP_001050605.1, _0112.001592_, 323536 Molecular Weight 25424.48 Da.
    Residues 232 Isoelectric Point 5.97
    Sequence miketvfksfdtpsaleqqlaskiasqlqeavdargkaslvvsggstplklfqllsmksidwsdvyitl aderwveadadasnerlvrehllqnrasnakfrglknmfstaeagadmaaeslsnfprpfdvvvlgmgn dghtcswfpcsaelenalttqalcvatnpttaphgritlsksailnsrqiylhlvgeqklsvyrqales ddvhampiravlaqrktpvdvfwsa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.40 Rfree 0.186
    Matthews' coefficent 2.48 Rfactor 0.168
    Waters 489 Solvent Content 50.49

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3nwp

    Protein Summary

    Note from Pfam: this protein didn't match Pfam, but it pretty soon became clear that this protein should have belonged to PF01182. I have rebuilt that family to include this protein

    Gene YP_001050605 from SHEWANELLA BALTICA OS155 encodes a protein with 232 residues,  whcih has annotated 6-phosphogluconolactonase. Sequence alignment indicates that this proteim belongs to the sugarP_isomerase superfamily.  Dali search even suggests this target be a glucose-6-phosphate 1-dehydrogenase or glucosamine-6-phosphate deaminase. More details for this structure's investigation will be presented in the future hopefully.

     

    398981_1.png

     

    Figure 1. The monomer of protein YP_001050605.

     

     

     

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     398981_1.png
    No description
    1790.12 kB23:35, 5 May 2010kevinjinActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch