.
The Open Protein Structure Annotation Network
PDB Keyword
.

3nrb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a formyltetrahydrofolate deformylase (purU, PP_1943) from PSEUDOMONAS PUTIDA KT2440 at 2.05 A resolution. To be published
    Site JCSG
    PDB Id 3nrb Target Id 398622
    Molecular Characteristics
    Source Pseudomonas putida kt2440
    Alias Ids TPS29654,NP_744095.1, _0004.004077_, 332387 Molecular Weight 32059.84 Da.
    Residues 286 Isoelectric Point 6.00
    Sequence mnknnqyvlslacqdapgivsevstflfnnganiveaeqfndedsskffmrvsveipvagvndfnsafg kvvekynaewwfrprtdrkkvvimvskfdhclgdllyrhrlgeldmevvgiisnhprealsvslvgdip fhylpvtpatkaaqesqiknivtqsqadlivlarymqilsddlsaflsgrcinihhsflpgfkgakpyh qahtrgvkligatahfvtadldegpiiaqdvehvshrdsaedlvrkgrdierrvlsravllfledrliv ngertvvfad
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.05 Rfree 0.240
    Matthews' coefficent 2.43 Rfactor 0.184
    Waters 785 Solvent Content 49.38

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3nrb
    1. Crystal structure of tandem ACT domain_containing protein ACTP from Galdieria sulphuraria
    E Bitto, DJ Kim, CA Bingman, HJ Kim - Proteins: Structure, , 2012 - Wiley Online Library
     

    Protein Summary

    Pfam: this target matchs both  ACT and Formyl_trans_N families in Pfam.

    Gene NP_744095 from Pseudomonas putida kt2440 encodes a protein with 286 residues.  In the each asymmetric unit cell, four subunits forms a tetramer as the biolomolecule suggested by PISA.  Analytical size exclusion chromatography also indicates a tetramer is a significantoligomerization state.  Sequence alignment for NCI Blast indicates that the N-terminal domain belongs to the  N-terminal ACT domain of formyltetrahydrofolate deformylase and the C-terminal domain belongs to the Formyl_trans_N super-family.   Dali and SSM also suggests this protein be a structural homolog to Phosphoribosylglycinamide formyltransferase and GLYCINAMIDE RIBONUCLEOTIDE TRANSFORMYLASE, respectively.

     

     

    398622_2.png

    Fig. 1 The monomer of protein NP_744095 with two domains.

     

    398622_1.png

     

    Fig. 2  The teramer of protein NP_744095 as the biomolecule.

     

     

     

     

     

     

     

     

     

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
     398622_1.png
    No description
    502.38 kB23:43, 21 Jun 2010kevinjinActions
     398622_2.png
    No description
    146.83 kB23:43, 21 Jun 2010kevinjinActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch