.
The Open Protein Structure Annotation Network
PDB Keyword
.

3nqn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Protein with unknown function. (DR_2006) from DEINOCOCCUS RADIODURANS at 1.88 A resolution. To be published
    Site JCSG
    PDB Id 3nqn Target Id 394616
    Molecular Characteristics
    Source Deinococcus radiodurans r1
    Alias Ids TPS25820,NP_295729.1, _0031.002125_, 325477 Molecular Weight 16467.85 Da.
    Residues 157 Isoelectric Point 5.05
    Sequence milsaeqsftlrhphgqaaalafvrepaaalagvrflrgldsdgeqvwgellvtvpllgevdlpfrsei vrtpqgaelrpltltgerawvavsgqataaeggemafafqfqahlatpeaegwggaafekmvqaaagrt lervakalpeglaaglppa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.88 Rfree 0.238
    Matthews' coefficent 2.40 Rfactor 0.196
    Waters 190 Solvent Content 48.76

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3nqn

    Protein Summary

    The structure of protein DR_2006 (target ID 394616) from Deinococcus radiodurans, one of the most radioresistant organisms known, was determined by three wavelength Se-MAD at a resolution of 1.88  Angstroms.  DR_2006 is a founding member of  a new PFAM family DUF3809 (PF12723). Members of this family are found in extremophiles from the Deinococcus-Thermus phylum. This family is distantly related to other uncharacterized PFAM families, DUF1997 (PF09366) and DUF1885 (PF08968), possibly forming a new clan. The latter relation is confirmed by a significant structural similarity to a representative from the DUF1885 family solved by MCSG (1t6a). 

     

    Shown below is a ribbons representation of the structure color-coded with the N-terminal end in blue and the C-terminal end in red.

    monomer.png

     

    The structure of target ID 394616 shows a TBP-like fold, a fold found in the TATA box-binding proteins. The structure indicates that a dimer (see below) is a biologically-significant oligomerization state. Shown below is a ribbon representation of the the dimer with the individual chains in blue and yellow respectively.

    dimer.png

     

    A DALI search shows that the structure of target ID 394616 is similar to these other structures

     

    PDB ID DALI Z-Score rmsd overlap (Angstroms) number of aligned residues total residues in target % sequence id Description
    3ggn 10.7 2.6 116 131 11 DR_A0006 from Deinococcus radiodurans. Northeaset Structural Genomics Consortium Target DrR147D
    2d4r 10.2 3.1 127 146 6  TTHA0849 from Thermus thermophilus HB8 at 2.4 Angstrom resolution: a putative member of the StAR-related lipid-transfer (START domain superfamily.
    2ns9 9.7 3.6 127 152 9 Protein APE2225 from Aeropyrim pernix,Pfam COXG
    2ejx 9.6 2.9 120 134 5

     Hypothetical protein ST0812 fromSulfolobus tokodaii

    2rez 8.7 3.3 119 155 6  Tetracenomycin ARO/CYC NaI Structure
    2e3p 8.3 3.1 131 231 4  CERT START domain in complex with C16-cearmide (P1)
    2e3r 8.3 3.1 131 226 4  CERT START domain in complex with C18-ceramide (P1)
    2res 8.3 3.4 120 152 5  Tetracenomycin ARO/CYC mutant R69A
    1jss 8.2 3.9 132 199 9  Mus musculus cholesterol-regulated START protein 4 (StarD4).


     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch