.
The Open Protein Structure Annotation Network
PDB Keyword
.

3n91

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a STRUCTURAL GENOMICS, UNKNOWN FUNCTION (BACOVA_03430) from Bacteroides ovatus at 2.40 A resolution. To be published
    Site JCSG
    PDB Id 3n91 Target Id 416727
    Molecular Characteristics
    Source Bacteroides ovatus atcc 8483
    Alias Ids TPS33825,ZP_02066433.1, 384457 Molecular Weight 35908.40 Da.
    Residues 322 Isoelectric Point 4.99
    Sequence sdnefpdfdyqtvyfanqyglrtielgesefvdntldnqhkmvikaawgggytnrnnvvinfkvdeslc dnlyfkdtdqplvpmpasyytlasdriaipkgqimagvevqltddffadeksisenyvipllmtnvqga dsilqgkpvvenpvltnagdwsilpqnfvlyavkyvnpwhgeylrrgidhatvagtskdiirheqfven devvnistksmkdnlltlktkdesgkdisytvrlsfaedgsctvhsgsqnvvvsgsgkfvskgeknslg gkdrnaiyldytvnltdnniqlatkdtlvlrtrnvyggkslevvrk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.220
    Matthews' coefficent 3.62 Rfactor 0.181
    Waters 179 Solvent Content 65.99

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3n91
    1. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     

    Protein Summary

    ZP_02066433.1 (BACOVA_03430) is a screted protein which can be divided into two domains: d1 (residues 30-196+333-344 ), and d2 (197-332). D2 is homologous to another jcsg structure 3h3i (Dali Z=10.2 for rmsd of 3.2A for 108 aligned Ca, seq id 14%). Other similar structures to D2 include: outer membrane protein W (2f1v), 2erv, and avidin (1ldo). D1 shares similar to NA/CA exchange protein (pdb 3e9u, Z=9.7), integrin beta-4 (pdb 3fso, Z=9.2).

     

    Based on annotations of sequence homologs in the database, this protein could be adhesin-like. Sequence analysis indicated that D1 matches DUF1735, which is related to another jcsg structure (416718).

     

    Fig 1.  Monomer of ZP_02066433.1

    sp16665a.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     sp16665a.png
    sp16665a
    102.77 kB17:52, 26 May 2010qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch