.
The Open Protein Structure Annotation Network
PDB Keyword
.

3n6z

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative immunoglobulin A1 protease (BACOVA_03286) from Bacteroides ovatus at 1.30 A resolution. To be published
    Site JCSG
    PDB Id 3n6z Target Id 416733
    Molecular Characteristics
    Source Bacteroides ovatus atcc 8483
    Alias Ids TPS33828,ZP_02066290.1, 384458 Molecular Weight 37631.63 Da.
    Residues 362 Isoelectric Point 4.90
    Sequence iscsdpnpldsytrvpfektetddgngdgdgdgagglfekgngtdskpymimnatqirnmrsvlksgmk vyfqlgadidmagiddwqslngsgdfpyeidfdgdshviknfkcsagdypsffgvlcgdcrnvgfvnas vssarqgigiitgylglkdkgngnktgrivncyttgevigsgaaggiagvlansydgqesyikncysna tvsdraasggkaggiagrkvgvggfiencyaygavsatkggvggilgqidkscdiaiknsaawsnltgv dasstvgrivgvsaslgsyencyacesivlkvnektitasdessatgttfhgvaksaeelgniivawnp nlwkkgtngypifqwse
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.30 Rfree 0.157
    Matthews' coefficent 2.49 Rfactor 0.135
    Waters 463 Solvent Content 50.63

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3n6z
    1. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     
    2. Fragment Finder 2.0: a computing server to identify structurally similar fragments
    R Nagarajan, S Siva Balan, R Sabarinathan - Journal of Applied , 2012 - scripts.iucr.org
     

    Protein Summary

    This sequence is related to Peptidase_M26_N and Glug domains. Glug domains are often involved in adhesion. The structure consists of an unusual right-handed beta helix which has not been seen before to our knowledge, even though the structure is partial similar to other beta helical structure.

     

    The significance of matching between this protein and Glug domains has yet to be explored.

     

    Fig 1. structure of 416733

    sp13881e.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     sp13881e.png
    SP13881E
    123.13 kB16:16, 19 May 2010qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch