.
The Open Protein Structure Annotation Network
PDB Keyword
.

3n6x

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Putative glutathionylspermidine synthase (Mfla_0391) from METHYLOBACILLUS FLAGELLATUS KT at 2.35 A resolution. To be published
    Site JCSG
    PDB Id 3n6x Target Id 374190
    Molecular Characteristics
    Source Methylobacillus flagellatus kt
    Alias Ids TPS6727,YP_544503.1, PF04174, PF04169, 519692 Molecular Weight 52673.47 Da.
    Residues 473 Isoelectric Point 5.11
    Sequence mdtaktkpfdemflqdevirpiyaeyaawlqdvphqqleskrqeaellfrrvgitfnvygedagaerli pfdvvprilsasewarlsdgaiqrvkalnmflhdvyhdqeiikagivpssilanaqyrpemfgvdvpgg vyahiagvdlvrtgendfyvlednlrtpsgvsymlenrkmmmrlfpelfrrypvapvehypqvllnnlr avaqagvheptvvlltpgaynsayfehafiaqqmgielvegqdlfvrnnavymrttegpkrvdviyrri dddfidplsfrpdsmlgvpgllsvyrnggvtlanavgtgvaddkdtyiyvpemirfylgeepilsnvpt yqlskaddlkyvldnlaelvvkevqgsggygmlvgpaaskqeledfrqrilanpanyiaqptlalstcp tlvetgiaprhvdlrpfvlsgktvslvpgalcrvalregslvvnssqgggtkdtwilkd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.35 Rfree 0.201
    Matthews' coefficent 3.45 Rfactor 0.178
    Waters 225 Solvent Content 64.34

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3n6x

    Protein Summary


    This protein matches two DUFS (DUF404 and DUF407), it belongs to CL0179 clan, the ATP-grasp clan. According to a recent paper by Aravind group, it represents a novel peptide synthesis and potential tagging system that is widely
    distributed in prokaryotes [Ref]. It is suggested that the substrate is likely a protein with a conserved Glu residue.

     

    This protein and another related ATP-GRASP structure by JCSG (PDB 3k1t) are both candidates for complex studies.

     

    Fig. 1. Structure

    pj04169h.png

    Ligand Summary

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     pj04169h.png
    pj04169h
    145.25 kB18:14, 10 May 2010qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch