.
The Open Protein Structure Annotation Network
PDB Keyword
.

3n0x

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an ABC-type branched-chain amino acid transporter (RPA4397) from Rhodopseudomonas palustris CGA009 at 1.50 A resolution. To be published
    Site JCSG
    PDB Id 3n0x Target Id 405167
    Molecular Characteristics
    Source Rhodopseudomonas palustris cga009
    Alias Ids TPS33721,NP_949733.1, BIG_798, 322696 Molecular Weight 40611.28 Da.
    Residues 373 Isoelectric Point 5.85
    Sequence addlkialiygktgpleayakqtetglmmgleyatkgtmtldgrkivvitkddqskpdlskaalaeayq ddgadiaigtsssaaaladlpvaeenkkilivepavadqitgekwnryifrtgrnssqdaisnavaigk qgvtiatlaqdyafgrdgvaafkealaktgatlateeyvpttttdftavgqrlfdalkdkpgkkiiwvi wagggdpltklqdmdpkrygielstggnilpalaaykrlpgmegatyyyydipknpinewlvtehqkrf nappdfftaggfsaamavvtavqkakstdtekliaamegmefdtpkgkmvfrkedhqalqsmyhfkvkv dpavawavlepvrelkieemnipiknkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.172
    Matthews' coefficent 2.12 Rfactor 0.148
    Waters 539 Solvent Content 41.90

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3n0x
    1. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     

    Protein Summary

    Pfam update: This protein is in our ANF_receptor (PF01094) family, for which there are many other structures. It is probably Q6N1K8.

    It is present as a monomer in the crystal structure. The putative active site is at Arg138 and the structure has a glycerol molecule from the cryoprotectant modeled at this site:

    Fig1.png

    Related proteins with similar structure can be found through the FFAS link above. A search with EBI-SSM of other proteins of similar structure results in significant top hits (Q-scores > 0.38 and rmsds < 2.9A) to PDB ids 3hut (branched-chain amino acid ABC transporter), 2lbp (leucine-binding protein), 2liv (leucine-binding protein), 3h5l (branched-chain amino acid aBC transporter), 3i45 (putative twin-arginine translocation pathway signal protein) and 1z15 (leu/isoleucine/valine-bindingp protein).

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     Fig1.png
    No description
    464.93 kB21:23, 4 May 2010debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch