.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mwx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative galactose mutarotase (BSU18360) from BACILLUS SUBTILIS at 1.45 A resolution. To be published
    Site JCSG
    PDB Id 3mwx Target Id 397864
    Molecular Characteristics
    Source Bacillus subtilis subsp. subtilis str. 168
    Alias Ids TPS30551,NP_389718.1, _0116.000991_, _0003.003178_, 327835 Molecular Weight 37226.22 Da.
    Residues 325 Isoelectric Point 5.64
    Sequence manfiekitylgtpaikagnehlemivvpewgsnvislvdkttnvqllrepetaesfhdtptlygipil fppnrisdgtfsfrgrtyhfdinekdkhnhlhgflyhekwnvvttkqtdegviveteidlselphvqkq fphhavvrmtytikentlfkhatvmnkgkeafpwgigyhttfifpaesslfsltadqqwelderllptg klmdvpykealhegmdlrhkqlddvflssyqkrggenqaviyhqhahisiiykadeqfkhwvvynadgk qgylcpepytwvtnavnldlpssltglqvlepgeettakssitielnhq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.45 Rfree 0.167
    Matthews' coefficent 2.73 Rfactor 0.148
    Waters 725 Solvent Content 54.96

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3mwx
    1. Assessment of ligand_binding residue predictions in CASP9
    T Schmidt, J Haas, TG Cassarino - Structure, Function, and , 2011 - Wiley Online Library
     
    2. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     

    Protein Summary

    The protein YoxA (renamed as GalM [Ref]) is an aldose-1-epimerase/Galactose mutarotase, supported by both sequence analysis and biochemical characterization (reference 1).

    The all-beta structure is most similar to Slr1438 ( PDB:3k25, rmsd 1.76A for 270 Ca atoms, seq id 20%), and PDB:3dcd, both by NESG. It is also similar to other characterized GalMs such as pdbs PDB:1l7j/PDB:1l7k[Ref], which allows identification of the active site near residues Arg71,  Asp230,  His101,  Glu282 etc (occupied by a glycerol, Fig 2).

    This structure is homologous (30% seq id) to 397745. 397745 shares 30% seq id to BsGalM, and is highly similar in structure  to BsGalM (rmsd 1.3A for 309 Ca).

     

    Fig. 1 Structure of 397864

    MI15933A-mono.png

    Fig. 2. Active site of BsGalM

    mi15933b-act.png

    Fig 3. Structure of 397745 in complex with PEG and Tartrate

    mi15933a.png

    Ligand Summary

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    2. (No Results)

       


      Discuss this publication
    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch