The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Putative signal transduction protein (Maqu_0641) from MARINOBACTER AQUAEOLEI VT8 at 2.25 A resolution. To be published
    Site JCSG
    PDB Id 3mem Target Id 403195
    Molecular Characteristics
    Source Marinobacter aquaeolei vt8
    Alias Ids TPS30649,YP_957926.1, _0076.003168_, 341214 Molecular Weight 50677.32 Da.
    Residues 456 Isoelectric Point 5.60
    Sequence melpvvvqqalgdnapgvsfrsvsqidtghllrmvllsddqgnlqaicrrndmldlealnkrlgrdlrm mqrreqvrvrqkaglqelpalpsltgwptvvdrrvdeleavalelgeqdlglmmpaedfrqltakaarh dfavdtanisvnldnhaadrdqlhsaikrftglriqqrledtlelpplpetaqriihlrvnpnavmgdl vdvvesdpslaaqvvswasssfyaaagrvhsvhdavsrvlgfdlvmnlamglalgralkhpqdhpdgyv dywqqaiwqaqsagilasmmprgqrplfglaylagllhnfghlvlaqvfpphfklvcrslevsphidss viehyllgitreqiaaqlmenwgmpdevtlairyqknpaydgphnvyarllwlgrqlltergvalgage satqavydelgldrelvqeqfdelvrrkdsimamagmmsqgg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.25 Rfree 0.227
    Matthews' coefficent 2.66 Rfactor 0.185
    Waters 280 Solvent Content 53.71

    Ligand Information


    Google Scholar output for 3mem

    Protein Summary

    Gene Maqu_0641 from from Marinobacter aquaeolei vt8 encodes a protein that is a homolog (42% id) to the SadB protein of Pseudomonas aeruginosa, which is involved in biofilm formation (1). The exact function of SadB is currently unknown.

    3mem structure contains two domains: N-terminal (10-131) corresponds to a prolyl t-RNA synthetase associated YbaK-like domain; and the C-terminal (183-383) is a HDOD domain.


    Fig 1. Structure of 3mem 


    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
    202.2 kB21:50, 2 Mar 2010qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch