.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mdp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Putative Cyclic nucleotide-binding protein (Gmet_1532) from Geobacter metallireducens GS-15 at 1.90 A resolution. To be published
    Site JCSG
    PDB Id 3mdp Target Id 402929
    Molecular Characteristics
    Source Geobacter metallireducens gs-15
    Alias Ids TPS30763,YP_384491.1, 2.60.120.10, 322376 Molecular Weight 15219.59 Da.
    Residues 141 Isoelectric Point 7.88
    Sequence misperlrvyrffasltdeqlkdialiseeksfptgsvifkenskadnlmllleggvelfysnggagsa anstvcsvvpgaifgvsslikpyhytssaratkpvrvvdingarlremsennqalgqvlmnnvaaavla rlh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.227
    Matthews' coefficent 2.63 Rfactor 0.181
    Waters 133 Solvent Content 53.28

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3mdp

    Protein Summary

    Pfam update:This is a structure in the cNMP binding domain family which has known structures already. So not of interest to us.

    Gene Gmet_1532 from Geobacter metallireducens gs-15 encodes the YP_384491 protein which belongs to the cyclic nucleotide (cNMP) binding domain family ( PF00027).  One protomer per asymmetric unit is found in the crystal structure of 3mdp. However, crystal packing analysis suggests that a dimer should be the stable oligomeric form in solution. A succinic acid (SIN) molecule is modeled at the putative active site of the protomer.

    mol..png

    Figure 1. 3mdp structure shows only one protomer in the asu. The SIN ligand is shown as stick.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     mol..png
    No description
    187.06 kB08:26, 18 Feb 2010gyewonActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch