.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mbh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative phosphomethylpyrimidine kinase (BT_4458) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.00 A resolution (orthorhombic form with pyridoxal). To be Published
    Site JCSG
    PDB Id 3mbh Target Id 375199
    Related PDB Ids 3mbj 
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi-5482
    Alias Ids TPS6837,NP_813369.1, 3.40.1190.20, 103977 Molecular Weight 32825.03 Da.
    Residues 290 Isoelectric Point 5.17
    Sequence myankvkkiaavhdlsgmgrvsltvvipilssmgfqvcplptavlsnhtqypgfsfldltdempkiiae wkklevqfdaiytgylgsprqiqivsdfikdfrqpdslivadpvlgdngrlytnfdmemvkemrhlitk advitpnltelfylldepykadstdeelkeylrllsdkgpqvviitsvpvhdephktsvyaynrqgnry wkvtcpylpahypgtgdtftsvitgslmqgdslpmaldratqfilqgiratfgyeydnregillekvlh nldmpiqmasyeli
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.00 Rfree 0.206
    Matthews' coefficent 2.32 Rfactor 0.167
    Waters 1023 Solvent Content 46.98

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3mbh

    Protein Summary

      This protein is now in family PF08543.5 Phos_pyr_kin, CL0118, and there are other structures

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch