.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lwf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative transcriptional regulator (NP_470886.1) from LISTERIA INNOCUA at 2.06 A resolution. To be published
    Site JCSG
    PDB Id 3lwf Target Id 396743
    Molecular Characteristics
    Source Listeria innocua clip11262
    Alias Ids TPS29586,NP_470886.1, 327019 Molecular Weight 15598.94 Da.
    Residues 140 Isoelectric Point 5.38
    Sequence mkittkgrygltitlelakrigdgpislrsiaqdknlsehyleqligplrnagivksirgahggyvlng dpekitagdiirtlegpivlvesmedeeaaqrelwtrmrnavrdvldqttlsdllkhstdseltdgymf yi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.06 Rfree 0.218
    Matthews' coefficent 2.83 Rfactor 0.180
    Waters 330 Solvent Content 56.59

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3lwf
    1. Insights into the Rrf2 repressor familythe structure of CymR, the global cysteine regulator of Bacillus subtilis
    W Shepard, O Soutourina, E Courtois, P England - FEBS , 2011 - Wiley Online Library
     

    Protein Summary

    This protein (lin1550) from Listeria innocua is a close homolog of global regulator CymR of B. subtilis and S. aureus (ref 1,2), which regulates the cysteine metabolism. It contains   a winged-helix domain at the N-terminus. The C-terminal region is involved in dimerization. It shares significant sequence and structural similarity to 1ylf and 1xd7 (20% id). It is a member of RRF2 HTH DNA binding protein.

     

    The structure was obtained in presence of sulfate which is one of small molecules that affects CymR activity.

     

    Fig 1. monomer of  396743

    ge8810cd-mon.png

    Fig 2. dimer

    ge8810cd-dimer.png

    Fig 3. vs 1xd7 (red)

    ge8810cd-vs1xd7.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (3)

    FileSizeDateAttached by 
     ge8810cd-dimer.png
    dimer of ge8810cd
    101.84 kB17:39, 18 Feb 2010qxuActions
     ge8810cd-mon.png
    monomer of ge8810cd
    93.08 kB17:34, 18 Feb 2010qxuActions
     ge8810cd-vs1xd7.png
    ge8810cd vs 1xd7
    109.58 kB17:48, 18 Feb 2010qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch