.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lwd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative 6-phosphogluconolactonase (YP_574786.1) from Chromohalobacter salexigens DSM 3043 at 1.88 A resolution. To be published
    Site JCSG
    PDB Id 3lwd Target Id 402861
    Molecular Characteristics
    Source Chromohalobacter salexigens dsm 3043
    Alias Ids TPS30757,YP_574786.1, 322391 Molecular Weight 23946.62 Da.
    Residues 225 Isoelectric Point 4.93
    Sequence mmnttqegrqrlaerladtvaqaleadlakrerallvvsggstpkpfftslaakalpwarvdvtlader wvtaddadsnarlvretllvgpaaeacfhplttdddtpeagvetvaerleslpwpasavilgmggdght aslfpdseqlatalettsaavvvhapsvpqaritlsasrladaglhvlhitgndkrrvlaealagddvr qlpiraflsqpiatywap
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.75 Rfree 0.18628
    Matthews' coefficent 2.92 Rfactor 0.15828
    Waters 248 Solvent Content 57.92

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3lwd

    Protein Summary

    Pfam Summary: The first match to this protein on building was in family Glucosamine_iso PF01182. This family has many other structures.

     

     

    The structure of  target id 402861 was determined by three-wavelengh Se-MAD at a resolution of 1.91 Angstroms. A fastSCOP search on the structure suggests that this target shows a NagB/RpiA/CoA-Transferase-like SCOP fold. Shown below is a ribbons representation of the structure of the monomer color-coded with the N-terminal end in blue and the C-terminal end in red. The structure is similar to 6-phosphoglucolactonase (EC 3.1.1.31) suggesting that this function is performed by this target. This enzyme performs the hydrolysis of 6-phosphoglucolactone to 6-phosphpgluconate, the second step of the pentose phosphate shunt.

    monomer.png

     

     

     The crystal structure suggests that a dimer is likely to be a significant oligomerization form in solution. Shown below is a ribbons representation of the dimer with the individual chains in blue and yellow.

     

    dimer.png

     

     

     A DALI search indicates that target ID 402861 shows structural similarity to the following structures:

    PDB ID
    DALI Z-Score
    RMSD (Angstroms)
    length of alignment
    number residues
    %sequence id
    Description
    3ico 26.6 1.9 213 244 26 Phosphoglucolactonase fro Myobacterium tuberculosis
    1vli 26.6 2.4 208 218 25 6-phosphoglucolactonase (TM1154 from Thermotoga maritima)
    1pbt 26.3 2.4 208 220 26 TM1154 oxidoreductase sol/devB family from Thermotoga maritima
    2bkv 23.9 2.3 206 241 19 Monomeric glucosamine-6-phosphate deaminase, missing link of the NagB superfamily.
    3eb9 23.8 2.3 214 263 26 6-phosphoglucolactonase from Trypanosoma brucei complexed with citrate
    3css 23.4 2.3 211 264 27 6-phosphoglucolactonase from Leishmania guaynesis
     3ch7 23.2 2.3 211 266 27 phosphoglucolactonase from Leishmania brazilensis
     1y89 23.2 2.3 206 238 27 devB protein
     3el5 23.1 2.2 212 295 18 6-phosphoglucolactonase from Plasmodium vivax

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     


     

     

     

     

     

     

     

     

     

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
     dimer.png
    No description
    361.45 kB20:15, 1 Feb 2010haxelrodActions
     monomer.png
    No description
    177.25 kB19:30, 1 Feb 2010haxelrodActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch