.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lul

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative 4-amino-4-deoxychorismate lyase. (YP_094631.1) from Legionella pneumophila subsp. pneumophila str. Philadelphia 1 at 1.78 A resolution. To be published
    Site JCSG
    PDB Id 3lul Target Id 403139
    Molecular Characteristics
    Source Legionella pneumophila subsp. pneumophila str. philadelphia 1
    Alias Ids TPS30641,YP_094631.1, _0069.000792_, _0114.000064_, 332530 Molecular Weight 30836.61 Da.
    Residues 271 Isoelectric Point 6.07
    Sequence mptrviedkgdmtpsfgiddriflgeglfetirvnsskpsfaymhwerlgnsarqlgipfeisfddwfe hliqkiqkdnlyhggikailsggpasrglaergqvsqlifqtfnysiqkhpvrlisinwlrdkanplyq lksvnyleaiiaqrqaiavgaddalffntenhvtettcanlfliennilytprvedgilpgitrarlis hcqqhkmsvqeisltkkriedadavfltnslqgirrvlsldniifevnhpiidklifllnqdes
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.78 Rfree 0.201
    Matthews' coefficent 2.16 Rfactor 0.160
    Waters 532 Solvent Content 42.97

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3lul
    1. Pseudomonas aeruginosa 4-Amino-4-Deoxychorismate Lyase: Spatial Conservation of an Active Site Tyrosine and Classification of Two Types of Enzyme
    PEF O'Rourke, TC Eadsforth, PK Fyfe, SM Shepherd - PloS one, 2011 - dx.plos.org
     

    Protein Summary

    Gene lpg0595 from Legionella pneumophila subsp. pneumophila str. philadelphia 1 encodes the YP_094631 protein that belongs to the aminotranferase class IV family (PF01063). Analysis of its genome context provides a functional link (score 0.98) with genes lpg1557, a para-amino benzoate synthase, and lpg2795, a 7,8-dihydropteroate synthase.

    3lul structure belongs to the multidomain protein class, D-amino acid aminotransferase-like PLP-dependent enzyme (super)family (SCOP). DALI top hits are with D-amino acid aminotransferase 3daa (Z=32), Ala aminotransferase 1g2w (Z=31), and the branch chain amino acid aminotransferase 1i1l (Z=31) and 1a3g (Z=30).

    3lul structure is significantly similar to 1et0 (Z=30), a 4-amino-4-deoxychorismate lyase, with a rmsd of 1.76 A for 246 Ca atoms, with a conserved active site.

     

    Fig 1. Structure of 3lul monomer

    mj0831a.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
     mj0831a.png
    mj0831a monomer
    137.09 kB21:22, 15 Jan 2010qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch