.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lub

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative creatinine amidohydrolase (YP_211512.1) from Bacteroides fragilis NCTC 9343 at 2.11 A resolution. To be published
    Site JCSG
    PDB Id 3lub Target Id 398858
    Molecular Characteristics
    Source Bacteroides fragilis nctc 9343
    Alias Ids TPS29662,YP_211512.1, _0038.001354_, 327778 Molecular Weight 28116.66 Da.
    Residues 253 Isoelectric Point 5.36
    Sequence mnkevdlsvsclgkvkelkydviilpwgatephnlhlpyltdcilphdiaveaaelalsrsgvrcmvmp pvpfgahnpgqrelpfcihtryatqqailedivsslhvqgfrkllilsghggnnfkgmirdlafeypdf liaaanwfevvspkgyfeaeiddhagesetsvmmhyhpelvnlaeagdgeskpfaiaslnekvawvprh wdkatvdsgvgnpkkataekgeryvkpiveklaglfeemaqhdlye
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 12
    Resolution (Å) 2.11 Rfree 0.193
    Matthews' coefficent 2.17 Rfactor 0.151
    Waters 2223 Solvent Content 43.28

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3lub

    Protein Summary

    YP_211512.1 encodes a protein which is highly similar in structure and active site to creatininase (Pdbs: 1j2t and 1q3k). The structure superimposes with 1j2t with rmsd of 1.7A for 212 aligned Ca, 26% seq id. The active sites are identical close to the metals, but is more accessible to solvent due to local conformation changes. It could be possible that the substrate perference may differ.

     

    Belongs to Creatinase Pfam family.

     

    Fig 1. YP_211512.1

    monomer-mi15794a.png

    Fig 2. hexamer with active site di-metals

    hexamer-mi15794a.png

    Fig 3. structural comparison with 1j2t (cyan)

    1j2t-monomer.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (3)

    FileSizeDateAttached by 
     1j2t-monomer.png
    1j2tA vs mi15794a monomer
    162.86 kB21:52, 20 Oct 2009qxuActions
     hexamer-mi15794a.png
    hexamer of mi15794a
    222.85 kB21:46, 20 Oct 2009qxuActions
     monomer-mi15794a.png
    monomer of mi15794a
    114.16 kB21:46, 20 Oct 2009qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch