.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lm2

    Title Crystal structure of Putative kinase. (17743352) from AGROBACTERIUM TUMEFACIENS str. C58 (Dupont) at 1.70 A resolution. To be published
    Site JCSG
    PDB Id 3lm2 Target Id 394250
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS26615,17743352, _0004.004598_, 325437 Molecular Weight 24537.87 Da.
    Residues 225 Isoelectric Point 5.67
    Sequence maedqtvlaidiggshvkiglstdgeerkvesgktmtgpemvaavtamakdmtydviamgypgpvvhnk plrepvnlgegwvgydyegafgrpvrivndalmqaigsynggrmlflglgtglgaamivenvaqpmeia hlpyrkgktyehyvseayrekkgnakwqkrvqdvverlsaalepdevvigggnverlenlppkcrrgdn amafeggfrlwknadliv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.186
    Matthews' coefficent 2.39 Rfactor 0.160
    Waters 384 Solvent Content 48.46

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3lm2

    Protein Summary

    Gene AGR_L_95 (Atu4836) translates into the NP_355828.1 protein. The sequence suggests it belongs to PFAM PF00480 of the repressor/ORF/kinase (ROK) family. This is confirmed by the genome context analysis which suggests that this protein is a polyphosphate glucokinase (EC 2.7.1.63).

     

    SCOp classifies 3lm2 in the alpha/beta class, actin-like ATPase domain superfamily, ROK family. The monomer and dimer structures are shown below.

    MH9105A.png  MH9105A_dimer.png

     

    The structural similarity as predicted by DALI using 3lm2 as query is listed below.

    DALI Structural Similarity with 3lm2
    N PDB Z-score RMSD LALI NRES %ID TITLE (JCSG structures highlighted in red)
    1 1woq 23.3 2.5 214 253 24 INORGANIC POLYPHOSPHATE/ATP-GLUCOMANNOKINASE
    2 3epq 20.7 2.4 209 294 21 PUTATIVE FRUCTOKINASE
    3 1xc3 20.4 2.3 207 295 20 PUTATIVE FRUCTOKINASE
    4 2aa4 20.0 2.6 214 289 19 PUTATIVE N-ACETYLMANNOSAMINE KINASE
    5 2gup 19.8 2.6 214 289 18 ROK FAMILY PROTEIN
    6 2qm1 19.5 2.7 213 325 24 GLUCOKINASE
    7 1sz2 19.5 2.6 210 319 18 GLUCOKINASE
    8 2hoe 19.2 2.8 216 354 18 N-ACETYLGLUCOSAMINE KINASE
    9 2q2r 19.1 2.6 212 370 21 GLUCOKINASE 1, PUTATIVE
    10 1q18 18.6 2.7 211 320 18 GLUCOKINASE

     

     

    A superposition of two of these structures on 3lm2 is shown below.

    MH9105A_1woq_1xc3.png

    3lm2 (green), 1woq (cyan), 1xc3 (magenta).

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch