.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lho

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative hydrolase (YP_751971.1) from Shewanella frigidimarina NCIMB 400 at 1.80 A resolution. To be published
    Site JCSG
    PDB Id 3lho Target Id 381550
    Molecular Characteristics
    Source Shewanella frigidimarina ncimb 400
    Alias Ids TPS26511,YP_751971.1, BIG_208, 91635 Molecular Weight 29593.91 Da.
    Residues 266 Isoelectric Point 5.23
    Sequence mhtdvnalfaalwqdyikmtpsaakihqllghgapiindhialrtfniakvnlsvlakhftsigyvdsg dykfeqkkliakhfehpdpkqpkvfisellveefspevqksihglidqvdiaattadnfiysgrhwdvd katyqallaeseyaawvaalgyranhftvsindlpeferiedvnqalkqagfvlnssggevkgspevll eqsstmadkvvvnftdgdveipscfyefarrypmangqlytgfvaasadkifestnamm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.207
    Matthews' coefficent 2.40 Rfactor 0.173
    Waters 206 Solvent Content 48.77

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3lho

    Protein Summary

    Gene Sfri_3296 from Shewanella frigidimarina ncimb 400 encodes the YP_751971 protein that lacks Pfam group. 3lho is similar to 2rjb , solved by NESG (Dali Z-scr=19) and 3iuz solved by JCSG (Dali Z-scr=25). 3lho is very likely a metal (zinc) hydrolase that might be involved in amino acid metabolism, based on its genomic context. Specifically, STRING provides a 0.626 scored hit with the arginine N-succinyltransferase YP_751973.

     

    Figure 1. 3lho monomer fold with bound metal (Ni)

    pu8578-1.png

    Figure 2. 3lho putative active site pocket (Ni depicted as white sphere)

    pu8578-2.png

    Figure 3. Structural superposition between 3lho (green), 3iuz (cyan)  and 2rjb (magenta)

    pu8578-3.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (3)

    FileSizeDateAttached by 
     pu8578-1.png
    monomer of pu8578a
    129.9 kB23:41, 10 Dec 2009qxuActions
     pu8578-2.png
    active pocket of pu8578a
    276.66 kB23:46, 10 Dec 2009qxuActions
     pu8578-3.png
    structure comparison
    197.93 kB23:54, 10 Dec 2009qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch