.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lhn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative lipoprotein (NP_718719.1) from Shewanella oneidensis at 1.42 A resolution. To be published
    Site JCSG
    PDB Id 3lhn Target Id 365930
    Molecular Characteristics
    Source Shewanella oneidensis mr-1
    Alias Ids TPS6201,NP_718719.1, PF04170 Molecular Weight 13389.26 Da.
    Residues 125 Isoelectric Point 4.62
    Sequence apsqgatanaetqttiplgdtsqnaldwpgvyegvlpcascegiqttltlqadnsfelksiylgkdesi fkvagkfdwdsngskitlsdgskylvgenqllmldtegnritgglaehyilkkkgm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.42 Rfree 0.181
    Matthews' coefficent 2.02 Rfactor 0.172
    Waters 229 Solvent Content 38.96

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3lhn

    Protein Summary

    Pfam Update: This protein is no in Family: NlpE (PF04170) which already has a few structures.

     

    Gene SO_3163 from SHEWANELLA ONEIDENSIS encodes the NP_718719.1 protein with 150 residues and an isoelectric point of 4.77.  The NCBI blast sequence alignment indicates that this protein contains a putative conserved domain belonging to NlpE superfamily. Accordingly, NP_718719.1 sequence belongs to the uncharacterized lipoprotein NlpE group involved in copper resistance (PF04170). Analysis of its genome context by STRING provides a hit with the neighboring sensor histidine kinase NP_718718.

     

    3lhn is a structurally similar (Dali Z-scr=11) to the Cpx Pathway Activator NlpE on the Outer Membrane of Escherichia coli (PDB ID: 2Z4H) [Ref].  As seen in 2z4h, the crystal interface interaction suggests that the biomolecule of 3lhn is a dimer.

     

    365930_2.png

     

    Figure 1. 3lhn monomer folds into a beta-barrel core.

     

     

    365930_1.png

     

    Figure 2. The biologically relevant dimer of 3lhn.

     

    365930_3.png

    Figure 3.  3hln (green) has a similar structure compared to 2z4h (pink).

    Ligand Summary

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch