.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kwk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative NADH dehydrogenase/NAD(P)H nitroreductase (NP_809094.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.54 A resolution. To be published
    Site JCSG
    PDB Id 3kwk Target Id 396185
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi-5482
    Alias Ids TPS25861,NP_809094.1, 3.40.109.10, 326089 Molecular Weight 19535.41 Da.
    Residues 174 Isoelectric Point 8.68
    Sequence ekgttgtgnaaldniferksvrtylnkgvekekidlmlragmsapsgkdvrpwefvvvsdrakldsmaa alpyakmltqarnaiivcgdsarsfywyldcsaaaqnillaaesmglgavwtaaypyedrmevvrkyth lpenilplcvipfgypatkeqpkqkydekkihynqy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.54 Rfree 0.176
    Matthews' coefficent 2.09 Rfactor 0.146
    Waters 276 Solvent Content 41.15

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3kwk

    Protein Summary

    Gene BT_0181 from Bacteriodes thetaiotaomicron vpi-5482 encodes the NP_809094 protein that belongs to the nitroreductase Pfam family ( PF00881 ). The uniprot reference id is  Q8ABC9_BACTN

    SCOP classifies 3kwk in the alpha+beta class, FMN-dependent nitroreductase-like superfamily, NADH oxidase/flavin reductase family. According to a DALI search, 3kwk shows high similarity with nitroreductase structures 3e39 (Z=21) and  3e10 (Z=24), followed by 3ge5 (Z=20) and 3koq (Z=19).

     

    fig_di_2.png

    3kwk is a monomer in the crystal structure and its crystal packing analysis suggests that it should be a dimer in solution. A flavin mononucleotide (FMN) molecule is modeled at the putative active site with clear density, even it was not in the crystallization condition.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
     fig_di_2.png
    dimer
    105.65 kB22:18, 25 Jun 2009lduanActions
     FMN_interaction.png
    FMN and residues within 4A
    208.52 kB22:18, 25 Jun 2009lduanActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch