.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kop

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Protein with a cyclophilin-like fold (YP_831253.1) from Arthrobacter sp. FB24 at 1.90 A resolution. To be published
    Site JCSG
    PDB Id 3kop Target Id 392654
    Molecular Characteristics
    Source Arthrobacter sp. fb24
    Alias Ids TPS27765,YP_831253.1, 323880 Molecular Weight 18425.62 Da.
    Residues 169 Isoelectric Point 4.51
    Sequence maryinitlekrgvtckalllddvaprtskavwdalpqssqvfhgkyarneiynlvpafapkepgaent tvtpipgdvcyftftsndlktpshgyeadsgtdevqtivdlavfygrnnlllngdtgwvpgnvfative gldemaaacqdiwmggardetltfsraedta
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.196
    Matthews' coefficent 2.28 Rfactor 0.160
    Waters 819 Solvent Content 46.10

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3kop

    Protein Summary

    Gene Arth_1761 from Arthrobacter sp. fb24 encodes the protein YP_831253, which has a similar structure to cyclophilin. No Pfam group has been defined yet for this sequence.

     SCOP classifies 3kop in the all-beta class, cyclophilin-like superfamily, TM1367-like family.

    According to DALI, 3kop highest structural similarity is with jcsg structure 1zx8 (Dali Z-scr=14; rmsd 1.96A for 112 aligned ca, 25% seq id). 3kop likely adopts a new hexameric form compared to previous structures. The putative active is near the domain interface. The potential active site is located near residues E51 and Y53 (conserved in 1zx8). Beyond the two residues above, the other residues are not conserved. Also the shape of the active site differs from that of 1zx8.

     

    Note from Pfam:

    This has proved an interesting structure as it has allowed me to create a clan of cyclophilin-like families. Nonetheless, I have still called this a DUF because there is no specific experimental evidence (DUF3830/PFPF12903).

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch