.
The Open Protein Structure Annotation Network
PDB Keyword
.

3k9t

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative peptidase (NP_348812.1) from CLOSTRIDIUM ACETOBUTYLICUM at 2.37 A resolution. To be published
    Site JCSG
    PDB Id 3k9t Target Id 393080
    Molecular Characteristics
    Source Clostridium acetobutylicum atcc 824
    Alias Ids TPS20301,NP_348812.1, 3.40.630.10 Molecular Weight 49867.26 Da.
    Residues 434 Isoelectric Point 5.56
    Sequence meeinkyiqnssetggeiynlieelfpicrsitgngvrktmdiirkhipleihevksgtkvfdwtvpke wnikdayvrnskgekvidfkennlhvmsysvpvhktmtldelkpylhtipgnkdripyltsyykenwgf sltqnkfdelcdddyevvidssledgsltygeyyirgeleeeillttytchpsmcndnlsgvalitfia kalsklktkysyrflfapetigsitwlsrnedklknikmglvatcvgdagiknykrtkfgdaeidkive kvlmhcgseyyvadffpwgsderqfsspginlpvgslmrscygfdgyhtsadnlcymnkdgladsykty leviytiennrtylnlnpkcepqlgkrgiyrmigggsdypfdefamfwvlnmsdgknslldiayksgme frrikyaadalyrvellklv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.37 Rfree 0.212
    Matthews' coefficent 3.79 Rfactor 0.169
    Waters 222 Solvent Content 67.52

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3k9t

    Protein Summary

    This protein is annotated as an aminopeptidase domain contaning protein belonging to a new Pfam family of DUFs, DUF2172, PF09940. This family is comprised of 44 proteins from 41 species, mostly (33 of them) from proteobacteria.

    Interestingly, the major portion of this protein is from the CATH family of Zinc Peptidases (CATH 3.40.630.10) which include proteins belonging to Pfam clan CL0035 from which the JCSG has solved numerous structures (Refer to the link in the Tags section at the bottom or click here for the Topsan page on Zinc peptidases solved at JCSG).

    Unlike the other members of CATH 3.40.630.10, this protein has a unique second domain insertion from the main zinc peptidase domain as well as a unique C-terminal HTH domain.

    Fig1.png

    Details from additional structural analysis will be presented later.

    Ligand Summary

    Zinc has been modeled at the putative active site based on anomalous difference Fourier maps and its addition as a co-crystallization compound.

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
     Fig1.png
    No description
    429.17 kB00:04, 27 Aug 2009debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch