.
The Open Protein Structure Annotation Network
PDB Keyword
.

3k50

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative S41 protease (YP_211611.1) from Bacteroides fragilis NCTC 9343 at 2.00 A resolution. To be published
    Site JCSG
    PDB Id 3k50 Target Id 393183
    Molecular Characteristics
    Source Bacteroides fragilis nctc 9343
    Alias Ids TPS26585,YP_211611.1, 324037 Molecular Weight 45120.72 Da.
    Residues 402 Isoelectric Point 4.78
    Sequence gvdrwpeyypetgrdiwidsvmrqeylwyrdmpspaapdyfqkpeaflkkavasmdngfskidslldep ipsygfdytlykvldndtaynalisyvvpgspaeeaglqrghwimmmngdyitkkvesellqgstrqlq igvykevvgedgevtggvvpigettmpasrslvdkpvhrfeiipwngkkvgylmynefkagpttdsqay nddlrrafrdfqtggvnefvldlryntggsldcaqllctmlapadkmnqllallrysdkrveanqdltf npeliqsganlnlstvyvlttnatrgaaemvinclnpymkvvligtktageyvatkpfvhptdrfilnl vvcnvynaeeksdyatgfkptyeynedsylstylpfgntnetllnaalkimsgitdk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.205
    Matthews' coefficent 2.26 Rfactor 0.157
    Waters 317 Solvent Content 45.55

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3k50

    Protein Summary

    Pfam: This protein is reassigned to in family PF03572 now.

     

    Gene YP_211611.1 encodes a protein with 425 residues from Bacteroides fragilis NCTC 9343 with Isoelectric Point of 5.0.  The NCI blast sequence alignment indicates that this protein contains two conserved domain belonging to PDZ_singaling and Peptidase_S41, respectively.  The PDZ signaling domain is assigned as PF00595 and Peptdidase_S41 superfamily belonging to PF03572.  Protein YP_211611.1 consists of 3 domains.  The interface interaction suggests that the biomolecule of YP_211611.1 be a monomer.
     

     

    393183_1.png

    Figure 1. Protein YP_211611.1 consists of 3 domains. The interface interaction suggests that the biomolecule of YP_211611.1 be a monomer.

     

     

    393183_2.png

     

    Figure 2. Protein YP_211611.1(green) is a structural homolog to 1JX7(cyan) sharing the 2nd domain and 3rd domain.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (2)

    FileSizeDateAttached by 
     393183_1.png
    No description
    180.25 kB20:06, 16 Jun 2009kevinjinActions
     393183_2.png
    No description
    262.22 kB20:06, 16 Jun 2009kevinjinActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch