The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative gamma-glutamylcysteine synthetase (YP_546622.1) from METHYLOBACILLUS FLAGELLATUS KT at 1.90 A resolution. To be published
    Site JCSG
    PDB Id 3k1t Target Id 381068
    Molecular Characteristics
    Source Methylobacillus flagellatus kt
    Alias Ids TPS27668,YP_546622.1, BIG_70, 382695 Molecular Weight 48315.68 Da.
    Residues 431 Isoelectric Point 5.49
    Sequence mmvphlttaltgplltlekrlldnmpriehwfrsqwqeygapfyasvdlrnagfklapvdtnlfpggfn nlnpdflplciqaamvavekicpdarrlllipenhtrntfylrnvhalthilrqaglevrigsiapeit aptflethdghsillepvrrkanrleldnfdscaillnndlsggipdilqgleqslipplhagwatrrk snhftaydrvveefaplididpwllnpyfdtcggldfharlgeeqlaekvdsllakirrkyaeygvkqe pfvivkadagtygmgimtvksaddvrdlnrkqrnkmsvvkeglkvsevilqegvytfehlkdavaepvi ymmdhfvvggfyrvhtsrgadenlnapgmhfepltfetpcstpdcagapdaapnrfyaygvvarlalla atielqetdpdlldert
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.160
    Matthews' coefficent 4.62 Rfactor 0.145
    Waters 583 Solvent Content 73.39

    Ligand Information


    Google Scholar output for 3k1t

    Protein Summary

    This protein is a homolog of a gamma-glutamylcysteine synthetase (ligase) (GshA) from Thiobacillus ferrooxodans PF08886 COG2918 EC The structure of this protein is similar (Dali Z-score 10.9; FATCAT P-val=3.1e-2) to human glutathione synthetase (PDB 2hgs), and very different from gamma-glutamylcysteine synthetase from Escherichia coli (PDBs 1v4g, 1va6). It is expected to bind ATP, Mg, Glu and Cys. It appears that the crystal structure is in a closed conformation, a complex with ligands would be greatly beneficial to the interpretation of the structure and ligand binding site (currently in progress).


    Figure 1. Structue of a monomer of YP_546622.1




    The gene for gamma-glutamylcysteine synthetase from Thiobacillus ferrooxidans has low homology to its Escherichia coli equivalent and is linked to the gene for citrate synthase. Powles R, Deane S, Rawlings D.

    Microbiology. 1996 Sep;142 ( Pt 9):2543-8. PMID: 8828222 [PubMed - indexed for MEDLINE]


    Ligand Summary




    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    143.75 kB16:52, 19 Aug 2009qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch